| Name | Recombinant Human Prokineticin-2 |
|---|---|
| Supplier | RayBiotech |
| Catalog | 213-10359-2 |
| Category | Protein |
| Prices | $190.00 |
| Sizes | 2 µg |
| Species Reactivities | Human |
| Nature | Recombinant |
| Source | Escherichia coli (E.coli) |
| Purity | 98% |
| Endotoxin | Endotoxin level is <0.1 ng/μg of protein (<1EU/μg). |
| Gene | PROK2 |
| Sequence | AVITGACDKDSQCGGGMCCAVSIWVKSIRICTPMGKLGDSCHPLTRKVPF FGRRMHHTCPCLPGLACLRTSFNRFICLAQK |
| Description | Prokineticin-2 (PK2) is a cysteine-rich secreted protein that is expressed in the testis and in lower levels of the small intestine |
| Supplier Page | Shop |