| Name | IL 1 beta Rat |
|---|---|
| Supplier | NeoScientific |
| Catalog | CYPS-401 |
| Category | Protein |
| Prices | $65.00, $169.00, $6,084.00 |
| Sizes | 2 µg, 10 µg, 1 mg |
| Species Reactivities | Rat |
| Nature | Recombinant |
| Source | Escherichia Coli. |
| Purity | Greater than 97.0% as determined by SDS-PAGE. |
| Bioactivity | The ED50 was found to be less than 0.1ng/ml, determined by the dose dependent proliferation of mouse D10S cells, corresponding to a specific activity of 10,000,000 units/mg. |
| Gene | Il1b |
| Sequence | MVPIRQLHCRLRDEQQKCLVLSDPCELKALHLNGQNISQQVVFSMSFVQGETSNDKIPVALGLKGLNLYLSCVMKDGTPTLQLESVDPKQYPKKKMEKRFVFNKIEVKTKVEFESAQFPNWYISTSQAEHRPVFLGNSNGRDIVDFTMEPVSS. |
| Description | Interleukin-1b Rat Recombinant produced in E.Coli is a non-glycosylated, Polypeptide chain containing 153 amino acids and having a molecular mass of 17.3 kDa.The IL-1b is purified by proprietary chromatographic techniques. |
| Supplier Page | Shop |