IL17E Mouse

• Supplier: NeoScientific
• Catalog: CYPS-648
• Category: Protein
• Prices: $65.00, $169.00, $3,510.00
• Sizes: 5 µg, 25 µg, 1 mg
• Species Reactivities: Mouse
• Nature: Recombinant
• Source: Escherichia Coli.
• Purity: Greater than 95.0% as determined by:(a) Analysis by RP-HPLC.(b) Analysis by SDS-PAGE.
• Bioactivity: The activity is determined by the dose-dependent production of IL-8 by human PBMCs and is 322-488ng/ml.
• Gene: Il25
• Sequence: VSLRIQEGCSHLPSCCPSKEQEPPEEWLKWSSASVSPPEPLSHTHHAESCRASKDGPLNSRAISPWSYELDRDLNRVPQDLYHARCLCPHCVSLQTGSHMDPLGNSVPLYHNQTVFYRRPCHGEEGTHRRYCLERRLYRVSLACVCVRPRVMA.
• Description: Recombinant mouse IL-17E is a non-glycosylated, disulfide-linked homodimer, containing 2x145 amino acid chains, with a total molecular weight of 35.5 kDa. The Mouse IL-17E is purified by proprietary chromatographic techniques.