Active mouse IL10 full length protein
| Name | Active mouse IL10 full length protein |
|---|---|
| Supplier | Abcam |
| Catalog | ab174083 |
| Category | Protein |
| Prices | $186.00 |
| Sizes | 10 µg |
| Applications | SDS-PAGE FA |
| Species Reactivities | Mouse |
| Nature | Recombinant |
| Source | HEK 293 cells |
| Purity | >95% by SDS-PAGE . |
| Bioactivity | The bio-activity was determined by dose-dependent co-stimulation (with IL-4) of the proliferation of Mouse MC/9 cells. The ED 50 was < 2 ng/ml, corresponding to a specific activity of > 5 x 10 5 units/mg. |
| Endotoxin | < 1.000 Eu/µg |
| SwissProt/Accession | P22301 |
| Gene | IL10 |
| Residue | 19 to 178 |
| Sequence | SRGQYSREDNNCTHFPVGQSHMLLELRTAFSQVKTFFQTKDQLDNILLTD SLMQDFKGYLGCQALSEMIQFYLVEVMPQAEKHGPEIKEHLNSLGEKLKT LRMRLRRCHRFLPCENKSKAVEQVKSDFNKLQDQGVYKAMNEFDIFINCI EAYMMIKMKS |
| Supplier Page | Shop |
Product images
Reduced SDS-PAGE analysis of ab174083, stained overnight with Coomassie Blue. Calculated MW of 19.2 kDa. DTT reduced protein migrates as 22 kDa due to glycosylation.