Rat IL-1 beta

• Supplier: ABBIOTEC
• Catalog: 600383
• Category: Protein
• Prices: $250.00
• Sizes: 10 µg
• Species Reactivities: Rat
• Nature: Recombinant
• Source: E. coli. Endotoxin level as measured by LAL is <0.05ng/ug or <0.5EU/ug.
• Purity: Purity > 95% as determined by RP-HPLC and reducing and non-reducing SDS-PAGE. Protein Content determined by UV spectroscopy at 280 nm and analysis by RP-HPLC calibrated against a known standard. Quantitation on SDS-PAGE against a known standard.
• Bioactivity: The activity is determined by the dose-dependent proliferation of mouse D10S cells and is typically less than 1 ng/mL. Specific activity: 1 x 10e6 units/mg
• Gene: Il1b
• Sequence: VPIRQLHCRLRDEQQKCLVLSDPCELKALHLNGQNISQQVVFSMSFVQGETSNDKIPVALGLKGLNLYLSCVMKDGTPTLQLESVDPKQYPKKKMEKRFVFNKIEVKTKVEFESAQFPNWYISTSQAEHRPVFLGNSNGRDIVDFTMEPVSS
• Description: Interleukin-1 beta (IL-1beta) is a pro-inflammatory cytokine, produced in response to inflammatory agents by a variety of cells, including, monocytes, macrophages, and dendritic cells (DCs). IL-1beta and IL-1alpha are two distinct and independently regulated gene products that comprise IL-1 and signal through the Type 1 IL-1 receptor (IL-1R1). Although IL-1alpha is cell associated and IL-1beta is secreted, they have nearly identical biological activity in that they induce adhesion molecule expression on epithelial cells, control fever induction, and play a role in arthritis and septic shock. Signaling activated by the IL-1R1 promotes these activities through a MYD88 signaling pathway similar to those associated with Toll receptors. Rat IL-1 beta is produced in E.coli. Recombinant rat IL-1beta is a non-glycosylated protein, containing 152 amino acids, with a molecular weight of 17.3 kDa.