Mouse IL-17E

• Supplier: ABBIOTEC
• Catalog: 600364
• Category: Protein
• Prices: $250.00
• Sizes: 25 µg
• Species Reactivities: Mouse
• Nature: Recombinant
• Source: E. coli. Endotoxin level as measured by LAL is <0.05ng/ug or <0.5EU/ug.
• Purity: Purity > 95% as determined by RP-HPLC and reducing and non-reducing SDS-PAGE. Protein Content determined by UV spectroscopy at 280 nm and analysis by RP-HPLC calibrated against a known standard. Quantitation on SDS-PAGE against a known standard.
• Bioactivity: The activity is determined by the dose-dependant production of IL-8 from cultured human PBMCs and is typically 10-100 ng/mL. Specific activity: 1 x 10e5 units/mg
• Gene: Il25
• Sequence: MVSLRIQEGCSHLPSCCPSKEQEPPEEWLKWSSASVSPPEPLSHTHHAESCRASKDGPLNSRAISPWSYELDRDLNRVPQDLYHARCLCPHCVSLQTGSHMDPLGNSVPLYHNQTVFYRRPCHGEEGTHRRYCLERRLYRVSLACVCVRPRVMA
• Description: Interleukin-17E (IL-17E), also commonly called IL-25, is a pro-inflammatory cytokine member of a six-species family of proteins (IL-17A-17F). IL-17F stimulates secretion of IL-8 and induces activation of NF-kB by binding to the receptor IL-17RB. Mouse IL-17E is produced in E.coli. Recombinant mouse IL-17E is a non-glycosylated, disulfide-linked homodimer, containing two 154 amino acid chains, with a total molecular weight of 35.5 kDa.