| Name | Corticotropin Releasing Factor Peptide |
|---|---|
| Supplier | ABBIOTEC |
| Catalog | 350132 |
| Category | Peptide |
| Prices | $280.00 |
| Sizes | 1 mg |
| Purity | Purity > 95% by HPLC |
| Gene | CRH |
| Sequence | Human, rat: H-Ser-Glu-Glu-Pro-Pro-Ile-Ser-Leu-Asp-Leu-Thr-Phe-His-Leu-Leu-Arg-Glu-Val-Leu-Glu-Met-Ala-Arg-Ala-Glu-Gln-Leu-Ala-Gln-Gln-Ala-His-Ser-Asn-Arg-Lys-Leu-Met-Glu-Ile-Ile-NH2 or H-SEEPPISLDLTFHLLREVLEMARAEQLAQQAHSNRKLMEII-NH2 |
| Description | Corticotropin releasing factor (CRF), a hormone from the hypothalamus, regulates the release of corticotropin (ACTH) and endorphin from the pituitary gland. CRF is also a neurotransmitter in the central nervous system, and is involved in autonomic and endocrine responses to stress. |
| Supplier Page | Shop |