Recombinant Human ATP7A

Name Recombinant Human ATP7A
Supplier Creative Biomart
Catalog ATP7A-27417TH
Category Protein
Nature Recombinant
Source Wheat germ
Purity Proprietary Purification
SwissProt/Accession Q04656
Gene ATP7A
Sequence FLKLYRKPTYESYELPARSQIGQKSPSEISVHVGIDDTSRNSPKLGLLDRIVNYSRASINSLLSDKRSLNSVVTSEPDKHSLLVGDFREDDDTAL
Description Recombinant fragment corresponding to amino acids 1406-1500 of Human ATP7A with an N terminal proprietary tag; Predicted MWt 36.08 kDa.
Supplier Page Shop