| Name | Recombinant Human CCR2 |
|---|---|
| Supplier | Creative Biomart |
| Catalog | CCR2-27804TH |
| Category | Protein |
| Nature | Recombinant |
| Source | Wheat germ |
| Purity | Proprietary Purification |
| SwissProt/Accession | P41597 |
| Gene | CCR2 |
| Sequence | MLSTSRSRFIRNTNESGEEVTTFFDYDYGAPCHKFDVKQIGA |
| Description | Recombinant fragment (amino acids 1-42) of Human CCR2 with a proprietarytag at the N terminal; 42 amino acids, Predicted MW 30.25 kDa, inclusive of tag. |
| Supplier Page | Shop |