| Name | Recombinant Human CDKN1C |
|---|---|
| Supplier | Creative Biomart |
| Catalog | CDKN1C-30575TH |
| Category | Protein |
| Nature | Recombinant |
| Source | Wheat germ |
| Purity | Proprietary Purification |
| SwissProt/Accession | P49918 |
| Gene | CDKN1C |
| Sequence | MSDASLRSTSTMERLVARGTFPVLVRTSACRSLFGPVDHEELSRELQARLAELNAEDQNRWDYDFQQDMPLRGPGRLQWTEVDSDSVPAFYRETVQVGRC |
| Description | Recombinant fragment (amino acids 1-100) of Human p57 Kip2 with proprietary 26 kDa tag; 100 amino acids (Predicted MW 11.45 kDa), 36.63 kDa inclusive of tag. |
| Supplier Page | Shop |