| Name | Active rat EGF full length protein |
|---|---|
| Supplier | Abcam |
| Catalog | ab198562 |
| Category | Protein |
| Prices | $300.00, $813.00 |
| Sizes | 100 µg, 500 µg |
| Applications | HPLC SDS-PAGE FA |
| Species Reactivities | Rat |
| Nature | Recombinant |
| Source | E. coli |
| Purity | >95% by SDS-PAGE . Protein Content and Purity (typically = 95%) determined by: HPLC, Reducing and Non-reducing SDS-PAGE, UV spectroscopy at 280 nm. |
| Bioactivity | The activity is determined by the dose-dependent proliferation of mouse BALB/c 3T3 cells and is typically less than 0.1 ng/mL. |
| Endotoxin | <=1.000 Eu/µg |
| SwissProt/Accession | P01133 |
| Gene | EGF |
| Residue | 974 to 1026 |
| Sequence | MNSNTGCPPSYDGYCLNGGVCMYVESVDRYVCNCVIGYIGERCQHRDLRW WKLR |
| Supplier Page | Shop |