| Name | Recombinant Human ENPEP, GST-tagged |
|---|---|
| Supplier | Creative Biomart |
| Catalog | ENPEP-27665TH |
| Category | Protein |
| Nature | Recombinant |
| Source | E. coli |
| SwissProt/Accession | Q07075 |
| Gene | ENPEP |
| Sequence | DLHVKPLL EEDTYTGTVSISINLSAPTRYLWLHLRETRITRLPELKRPSGDQVQVRRCFEYKKQEY |
| Description | Recombinant fragment: DLHVKPLLE EDTYTGTVSI SINLSAPTRY LWLHLRETRI TRLPELKRPS GDQVQVRRCF EYKKQEY, corresponding to amino acids 103-168 of Human BP1; GST tag is about 25-26 kDa and BP1 with GST tag is about 35 kDa.66 amino acids, 35kDa. |
| Supplier Page | Shop |