Rat beta 2 Microglobulin full length protein
| Name | Rat beta 2 Microglobulin full length protein |
|---|---|
| Supplier | Abcam |
| Catalog | ab185254 |
| Category | Protein |
| Applications | SDS-PAGE |
| Species Reactivities | Rat |
| Nature | Recombinant |
| Source | HEK 293 cells |
| Tag/Conjugation | His tag C-Terminus |
| Purity | >95% by SDS-PAGE . |
| Endotoxin | < 1.000 Eu/µg |
| SwissProt/Accession | P61769 |
| Gene | B2M |
| Residue | 21 to 119 |
| Sequence | IQKTPQIQVYSRHPPENGKPNFLNCYVSQFHPPQIEIELLKNGKKIPNIE MSDLSFSKDWSFYILAHTEFTPTETDVYACRVKHVTLKEPKTVTWDRDM |
| Supplier Page | Shop |
Product images
DTT-reduced SDS-PAGE analysis of ab185254 stained overnight with Coomassie Blue. DTT-reduced protein migrates as 15 kDa.