Recombinant Swine IL-6

• Supplier: Creative Biomart
• Catalog: IL6-29S
• Category: Protein
• Species Reactivities: Pig
• Nature: Recombinant
• Source: Yeast
• Bioactivity: The biological activity of recombinant swine IL-6 was measured in a cell proliferation assay using the mouse B9 cell line. The ED50 for this effect is typically 1-10 pg/mL.
• Gene: IL6
• Sequence: GRLEEDAKGDATSDKMLFTSPDKTEELIKYILGKISAMRKEMCEKYEKCENSKEVLAENNLNLPKMAEKDGCFQSGFNQETCLMRITTGLVEFQIYLDYLQKEYESNKGNVEAVQISTKALIQTLRQKGKNPDKATTPNPTTNAGLLDKLQSQNEWMKNTKIILILRSLEDFLQFSLRAIRIM (183)
• Description: Swine IL-6 was produced in yeast and therefore does not have endotoxin, is naturally folded, and post-translationally modified.