Recombinant Human MSH2

Name Recombinant Human MSH2
Supplier Creative Biomart
Catalog MSH2-28793TH
Category Protein
Nature Recombinant
Source Wheat germ
Purity Proprietary Purification
SwissProt/Accession P43246
Gene MSH2
Sequence NFPKHVIECAKQKALELEEFQYIGESQGYDIMEPAAKKCYLEREQGEKIIQEFLSKVKQMPFTEMSEENITIKLKQLKAEVIAKNNSFVNEIISRIKVTT
Description Recombinant fragment corresponding to amino acids 835-934 of Human MSH2 with an N terminal proprietary tag; Predicted MWt 36.63 kDa.
Supplier Page Shop