| Name | Recombinant Human NAT1, Fc-tagged |
|---|---|
| Supplier | Creative Biomart |
| Catalog | NAT1-30283TH |
| Category | Protein |
| Species Reactivities | Human |
| Nature | Recombinant |
| Source | Wheat germ |
| Purity | Proprietary Purification |
| SwissProt/Accession | P18440 |
| Gene | NAT1 |
| Sequence | DFESMNTYLQTSPSSVFTSKSFCSLQTPDGVHCLVGFTLTHRRFNYKDNTDLIEFKTLSEEEIEKVLKNIFNISLQRKLVPKHGDRFFTI |
| Description | Recombinant fragment: DFESMNTYLQ TSPSSVFTSK SFCSLQTPDG VHCLVGFTLT HRRFNYKDNT DLIEFKTLSE EEIEKVLKNI FNISLQRKLV PKHGDRFFTI of Human NAT1 (amino acids 201-290) with N terminal proprietary tag, 35.53 kDa. |
| Supplier Page | Shop |