Name | Recombinant Human OVOL1 |
---|---|
Supplier | Creative Biomart |
Catalog | OVOL1-30527TH |
Category | Protein |
Species Reactivities | Human |
Nature | Recombinant |
Source | Wheat germ |
Purity | Proprietary Purification |
SwissProt/Accession | O14753 |
Gene | OVOL1 |
Sequence | PRAFLVKKPCVSTCKRNWSELPDEERGEIYVPVSLGFCPPQPYREPEPSVAEPPSCPLALNMSLRDSSYSMAPGPCVVAQLPSEDMGHLTDPQSRDHGF |
Description | Recombinant fragment of Human OVOL1 amino acids 2-100 with a N terminal proprietary tag; Predicted MWt 36.52 kDa including the tag. |
Supplier Page | Shop |