Recombinant Human OVOL1

Name Recombinant Human OVOL1
Supplier Creative Biomart
Catalog OVOL1-30527TH
Category Protein
Species Reactivities Human
Nature Recombinant
Source Wheat germ
Purity Proprietary Purification
SwissProt/Accession O14753
Gene OVOL1
Sequence PRAFLVKKPCVSTCKRNWSELPDEERGEIYVPVSLGFCPPQPYREPEPSVAEPPSCPLALNMSLRDSSYSMAPGPCVVAQLPSEDMGHLTDPQSRDHGF
Description Recombinant fragment of Human OVOL1 amino acids 2-100 with a N terminal proprietary tag; Predicted MWt 36.52 kDa including the tag.
Supplier Page Shop