Recombinant Human SLC15A1

Name Recombinant Human SLC15A1
Supplier Creative Biomart
Catalog SLC15A1-30924TH
Category Protein
Nature Recombinant
Source Wheat germ
Purity Proprietary Purification
SwissProt/Accession P46059
Gene SLC15A1
Sequence VKDGLNQKPEKGENGIRFVNTFNELITITMSGKVYANISSYNASTYQFFPSGIKGFTISSTEIPPQCQPNFNTFYLEFGSAYTYIVQRKNDSCPEVKVFE
Description Recombinant fragment (amino acids 473-572) of Human SLC15A1 with a proprietary tag at the N terminal; Predicted MW 36.63 kDa, inclusive of tag.
Supplier Page Shop