| Name | Recombinant Melatonin Receptor 1A (MTNR1A) |
|---|---|
| Supplier | Cloud-clone |
| Catalog | RPC945Hu01 |
| Category | Protein |
| Applications | SDS-PAGE WB ELISA IP |
| Species Reactivities | Human |
| Nature | Recombinant |
| Source | E.coli |
| Purity | > 95% |
| Endotoxin | <1.0EU per 1µg (determined by the LAL method) |
| Gene | MT1E |
| Residue | Gly296~Val350 (Accession # P48039) with two N-terminal Tags, His-tag and S-tag |
| Sequence | The target protein is fused with two N-terminal Tags, His-tag and S-tag, its sequence is listed below. MHHHHHHSSGLVPRGSGMKETAAAKFERQHMDSPDLGTDDDDKAMADIGSEF-GLLNQ NFRKEYRRII VSLCTARVFF VDSSNDVADR VKWKPSPLMT NNNVVKVDSV |
| Supplier Page | Shop |