Recombinant human Zinc finger protein GLI1

Name Recombinant human Zinc finger protein GLI1
Supplier Cusabio
Catalog CSB-EP129894h CSB-BP129894h CSB-MP129894h
Category Protein
Species Reactivities Human
Nature Recombinant
Source E.coli or Baculovirus or Mammalian cell
Tag/Conjugation His-tag
SwissProt/Accession P08151
Gene GLI1
Residue 921-1106aa
Sequence QEPSYQSPKFLGGSQVSPSRAKAPVNTYGPGFGPNLPNHKSGSYPTPSPCHENFVVGANRASHRAAAPPRLLPPLPTCYGPLKVGGTNPSCGHPEVGRLGGGPALYPPPEGQVCNPLDSLDLDNTQLDFVAILDEPQGLSPPPSHDQRGSSGHTPPPSGPPNMAVGNMSVLLRSLPGETEFLNSSA
Description Partial of the full length of 1-1106aa
Supplier Page Shop