Recombinant human Replication protein A 14 kDa subunit

Name Recombinant human Replication protein A 14 kDa subunit
Supplier Cusabio
Catalog CSB-EP162344h CSB-BP162344h CSB-MP162344h
Category Protein
Species Reactivities Human
Nature Recombinant
Source E.coli or Baculovirus or Mammalian cell
Tag/Conjugation GST-tag
SwissProt/Accession P35244
Gene RPA3
Residue 1-119aa
Sequence MVDMMDLPRSRINAGMLAQFIDKPVCFVGRLEKIHPTGKMFILSDGEGKNGTIELMEPLDEEISGIVEVVGRVTAKATILCTSYVQFKEDSHPFDLGLYNEAVKIIHDFPQFYPLGIVQ
Description Partial of the full length of 1-121aa
Supplier Page Shop