Active human BCA1 full length protein

• Supplier: Abcam
• Catalog: ab202782
• Category: Protein
• Prices: $359.00
• Sizes: 5 µg
• Applications: SDS-PAGE FA HPLC
• Species Reactivities: Human
• Nature: Recombinant
• Source: E. coli
• Purity: > 97 % by SDS-PAGE. > 97 % by HPLC.
• Bioactivity: Measured by its ability to chemoattract human CXCR5 transfected BaF3 mouse pro-B cells.The ED 50 for this effect is typically 0.005-0.02 μg/mL.
• Endotoxin: < 1.000 Eu/µg
• SwissProt/Accession: O43927
• Gene: CXCL13
• Residue: 23 to 109
• Sequence: VLEVYYTSLRCRCVQESSVFIPRRFIDRIQILPRGNGCPRKEIIVWKKNK SIVCVDPQAEWIQRMMEVLRKRSSSTLPVPVFKRKIP