Recombinant Mouse OX40 Ligand/TNFSF4 Protein
| Name | Recombinant Mouse OX40 Ligand/TNFSF4 Protein |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP2-26577 |
| Category | Protein |
| Prices | $299.00, $7,999.00 |
| Sizes | 50 µg, 5 mg |
| Nature | Recombinant |
| Purity | Protein A purified |
| Bioactivity | In vitro proliferation assay, in vivo assays.This protein was measured by its ability to co-stimulate IL-2 secretion in the presence of anti-mCD3, and agonist antibody OX86. |
| Endotoxin | Endotoxin level < 0.1 EU/ug of the protein (< 0.01 ng/ug of the protein) as determined by the LAL test. |
| Gene | Tnfsf4 |
| Sequence | EPRGPTIKPCPPCKCPAPNLLGGPSVFIFPPKIKDVLMISLSPIVTCVVVDVSEDDPDVQISWFVNNVEVHTAQTQTHREDYNSTLRVVSALPIQHQDWMSGKEFKCKVNNKDLPAPIERTISKPKGSVRAPQVYVLPPPEEEMTKKQVTLTCMVTDFMPEDIYVEWTNNGKTELNYKNTEPVLDSDGSYFMYSKLRVEKKNWVERNSYSCSVVHEGLHNHHTTKSFSRTPGK |
| Description | A recombinant protein corresponding to TNFSF4 |
| Supplier Page | Shop |
Product images
![In vitro assay: TNFSF4 Protein [NBP2-26577] - Demonstration in vitro of the potency of Fc-OX40L in comparison to an agonist antibody OX86, with anti-CD3 alone serving as a negative control for co-stimulation.](http://www.bioprodhub.com/system/product_images/pp_products/5/sub_1/19633_TNFSF4-Protein-In-vitro-assay-NBP2-26577-img0001.jpg)
In vitro assay: TNFSF4 Protein [NBP2-26577] - Demonstration in vitro of the potency of Fc-OX40L in comparison to an agonist antibody OX86, with anti-CD3 alone serving as a negative control for co-stimulation.
![SDS-Page: TNFSF4 Protein [NBP2-26577] - Electrophoretic analysis of Fc-mOX40L using Coomassie blue stained 4-20% reducing SDS-PAGE.](http://www.bioprodhub.com/system/product_images/pp_products/5/sub_1/19634_TNFSF4-Protein-SDS-Page-NBP2-26577-img0002.jpg)
SDS-Page: TNFSF4 Protein [NBP2-26577] - Electrophoretic analysis of Fc-mOX40L using Coomassie blue stained 4-20% reducing SDS-PAGE.