Recombinant Human Prokineticin 2 Protein

• Supplier: Novus Biologicals
• Catalog: H00060675-Q01
• Category: Protein
• Prices: $319.00
• Sizes: 2 µg
• Applications: WB ELISA Array
• Species Reactivities: Human
• Nature: Recombinant
• Source: Wheat Germ
• Bioactivity: This protein is not active and should not be used for experiments requiring activity.
• Gene: PROK2
• Sequence: LTPRAGDAAVITGACDKDSQCGGGMCCAVSIWVKSIRICTPMGKLGDSCHPLTRKVPFFGRRMHHTCPCLPGLACLRTSFNRFICLAQK
• Description: Prokineticin 2 (Human) GST-Tagged Recombinant Protein Source: Wheat Germ (in vitro) Amino Acid Sequence: LTPRAGDAAVITGACDKDSQCGGGMCCAVSIWVKSIRICTPMGKLGDSCHPLTRKVPFFGRRMHHTCPCLPGLACLRTSFNRFICLAQK