| Name | Human BCMA protein fragment |
|---|---|
| Supplier | Abcam |
| Catalog | ab111458 |
| Category | Protein |
| Prices | $297.00 |
| Sizes | 20 µg |
| Applications | SDS-PAGE HPLC |
| Species Reactivities | Human |
| Nature | Recombinant |
| Source | E. coli |
| Purity | >= 98 % by SDS-PAGE. ab111458 is purified by standard chromatographic techniques. Purity is greater than 98% by HPLC and SDS-PAGE. |
| SwissProt/Accession | Q02223 |
| Gene | TNFRSF17 |
| Residue | 5 to 54 |
| Sequence | AGQCSQNEYFDSLLHACIPCQLRCSSNTPPLTCQRYCNASVTNSVKGTNA |
| Supplier Page | Shop |