Human BRD2 protein fragment
| Name | Human BRD2 protein fragment |
|---|---|
| Supplier | Abcam |
| Catalog | ab196121 |
| Category | Protein |
| Prices | $837.00 |
| Sizes | 100 µg |
| Applications | SDS-PAGE ELISA |
| Species Reactivities | Human |
| Nature | Recombinant |
| Source | E. coli |
| Tag/Conjugation | His tag N-Terminus |
| Purity | >95% by SDS-PAGE . |
| SwissProt/Accession | P25440 |
| Gene | BRD2 |
| Residue | 339 to 459 |
| Sequence | QSSKKGKLSEQLKHCNGILKELLSKKHAAYAWPFYKPVDASALGLHDYHD IIKHPMDLSTVKRKMENRDYRDAQEFAADVRLMFSNCYKYNPPDHDVVAM ARKLQDVFEFRYAKMPDEPLE |
| Supplier Page | Shop |
Product images
4-20% SDS-PAGE with Coomassie stain. Lane 1: 4.2 µg Human BRD2 protein fragment (ab196121) Lane 2: Protein marker
ab196121 is incubated with biotinylated acetyl-histone peptide substrate in assay buffer in a 10 µl reaction for 1 hour at RT. Proprietary Nickel Chelate acceptor beads are added, followed by proprietary Streptavidin-conjugated donor beads. After 1 hour minute incubation at RT, signal is measured.