Active human Cystatin SA full length protein
| Name | Active human Cystatin SA full length protein |
|---|---|
| Supplier | Abcam |
| Catalog | ab180061 |
| Category | Protein |
| Prices | $414.00 |
| Sizes | 50 µg |
| Applications | FA SDS-PAGE |
| Species Reactivities | Human |
| Nature | Recombinant |
| Source | HEK 293 cells |
| Tag/Conjugation | His tag C-Terminus |
| Purity | >95% by SDS-PAGE . |
| Bioactivity | Measured by its ability to inhibit active Cathepsin L cleavage of a fluorogenic peptide substrate Z-LR-AMC. The IC 50 value is < 10.0 nM. |
| Endotoxin | < 1.000 Eu/µg |
| SwissProt/Accession | P09228 |
| Gene | CST2 |
| Residue | 21 to 141 |
| Sequence | WSPQEEDRIIEGGIYDADLNDERVQRALHFVISEYNKATEDEYYRRLLRV LRAREQIVGGVNYFFDIEVGRTICTKSQPNLDTCAFHEQPELQKKQLCSF QIYEVPWEDRMSLVNSRCQEA |
| Supplier Page | Shop |
Product images
SDS-PAGE analysis of ab180061 in reducing conditions. Gel stained overnight with Coomassie Blue. DTT-reduced protein migrates as 15-17 kDa.