Human CCL4L1 full length protein
| Name | Human CCL4L1 full length protein |
|---|---|
| Supplier | Abcam |
| Catalog | ab107149 |
| Category | Protein |
| Prices | $297.00, $1,210.00 |
| Sizes | 50 µg, 250 µg |
| Applications | SDS-PAGE MS |
| Species Reactivities | Human |
| Nature | Recombinant |
| Source | E. coli |
| Tag/Conjugation | His tag N-Terminus |
| Purity | > 90 % by SDS-PAGE. ab107149 was purified by conventional chromatography, after refolding of the isolated inclusion bodies in a renaturation buffer. |
| Endotoxin | < 1.000 Eu/µg |
| SwissProt/Accession | Q8NHW4 |
| Gene | CCL4L2 |
| Residue | 24 to 92 |
| Sequence | MGSSHHHHHHSSGLVPRGSHMGSHMAPMGSDPPTACCFSYTARKLPRNFV VDYYETSSLCSQPAVVFQTKRGKQVCADPSESWVQEYVYDLELN |
| Supplier Page | Shop |
Product images
15% SDS-PAGE showing ab107149 (3µg). Note: Molecular weight on SDS-PAGE will appear higher than predicted.