Human CD130 (gp130) protein fragment
| Name | Human CD130 (gp130) protein fragment |
|---|---|
| Supplier | Abcam |
| Catalog | ab114303 |
| Category | Protein |
| Prices | $420.00 |
| Sizes | 10 µg |
| Applications | WB ELISA SDS-PAGE |
| Species Reactivities | Human |
| Nature | Recombinant |
| Source | Wheat germ |
| SwissProt/Accession | P40189 |
| Gene | IL6ST |
| Residue | 23 to 122 |
| Sequence | ELLDPCGYISPESPVVQLHSNFTAVCVLKEKCMDYFHVNANYIVWKTNHF TIPKEQYTIINRTASSVTFTDIASLNIQLTCNILTFGQLEQNVYGITIIS |
| Supplier Page | Shop |
Product images
12.5% SDS-PAGE image showing ab114303 at approx 36.63 kDa. Stained with Coomassie Blue.