Recombinant Human IRF3 Protein
| Name | Recombinant Human IRF3 Protein |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBC1-18469 |
| Category | Protein |
| Prices | $269.00 |
| Sizes | 100 µg |
| Applications | SDS-PAGE |
| Species Reactivities | Human |
| Nature | Recombinant |
| Purity | >95% pure by SDS-PAGE |
| Gene | IRF3 |
| Sequence | MGTPKPRILPWLVSQLDLGQLEGVAWVNKSRTRFRIPWKHGLRQDAQQEDFGIFQAWAEATGAYVPGRDKPDLPTWKRNFRSALNRKEGLRLAEDRSKDPHDPHKIYEFVNS |
| Description | A recombinant protein corresponding to amino acids 1 - 112 of IRF3 |
| Supplier Page | Shop |
Product images
![SDS-Page: IRF3 Protein [NBC1-18469] - Interferon regulatory factor 3, 13.0kDa (112aa), confirmed by MALDI-TOF with a purity of 95% by SDS - PAGE](http://www.bioprodhub.com/system/product_images/pp_products/5/sub_1/28764_IRF3%2520Protein-SDS-Page-NBC1-18469-img0001.jpg)
SDS-Page: IRF3 Protein [NBC1-18469] - Interferon regulatory factor 3, 13.0kDa (112aa), confirmed by MALDI-TOF with a purity of 95% by SDS - PAGE