Recombinant Human HSP10/EPF Protein
| Name | Recombinant Human HSP10/EPF Protein |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBC1-18371 |
| Category | Protein |
| Prices | $269.00 |
| Sizes | 100 µg |
| Applications | SDS-PAGE |
| Species Reactivities | Human |
| Nature | Recombinant |
| Purity | >95% pure by SDS-PAGE |
| Endotoxin | < 1.0 EU per 1 microgram of protein (determined by LAL method) |
| Gene | HSPE1 |
| Sequence | MAGQAFRKFLPLFDRVLVERSAAETVTKGGIMLPEKSQGKVLQATVVAVGSGSKGKGGEIQPVSVKVGDKVLLPEYGGTKVVLDDKDYFLFRDGDILGKYVD |
| Description | A recombinant protein corresponding to amino acids 1 - 102 of HSPE1 |
| Supplier Page | Shop |
Product images
![SDS-Page: Hsp10 Protein [NBC1-18371] - Hsp10, 10 kDa (102 aa), confirmed by MALDI-TOF with a purity of 95% by SDS - PAGE](http://www.bioprodhub.com/system/product_images/pp_products/5/sub_1/29213_Hsp10-Protein-SDS-Page-NBC1-18371-img0002.jpg)
SDS-Page: Hsp10 Protein [NBC1-18371] - Hsp10, 10 kDa (102 aa), confirmed by MALDI-TOF with a purity of 95% by SDS - PAGE