Active human Fas protein fragment
| Name | Active human Fas protein fragment |
|---|---|
| Supplier | Abcam |
| Catalog | ab155635 |
| Category | Protein |
| Prices | $352.00 |
| Sizes | 100 µg |
| Applications | FA SDS-PAGE |
| Species Reactivities | Human |
| Nature | Recombinant |
| Source | HEK 293 cells |
| Purity | >95% by SDS-PAGE . |
| Bioactivity | Measured by its ability to inhibit Fas Ligand-induced apoptosis of Jurkat Human acute T cell leukemia cells. The ED 50 for this effect is typically 8-35 pg/ml in the presence of 2 ng/ml recombinant human Fas Ligand. |
| Endotoxin | < 1.000 Eu/µg |
| SwissProt/Accession | P25445 |
| Gene | FAS |
| Residue | 26 to 173 |
| Sequence | QVTDINSKGLELRKTVTTVETQNLEGLHHDGQFCHKPCPPGERKARDCTV NGDEPDCVPCQEGKEYTDKAHFSSKCRRCRLCDEGHGLEVEINCTRTQNT KCRCKPNFFCNSTVCEHCDPCTKCEHGIIKECTLTSNTKCKEEGSRSN |
| Supplier Page | Shop |
Product images
SDS PAGE analysis of reduced ab155635 stained overnight with Coomassie Blue.