Active human Fc epsilon RI protein fragment
| Name | Active human Fc epsilon RI protein fragment |
|---|---|
| Supplier | Abcam |
| Catalog | ab182693 |
| Category | Protein |
| Prices | $357.00 |
| Sizes | 100 µg |
| Applications | SDS-PAGE FA |
| Species Reactivities | Human |
| Nature | Recombinant |
| Source | HEK 293 cells |
| Tag/Conjugation | His tag C-Terminus |
| Purity | >90% by SDS-PAGE. |
| Bioactivity | Measured by its binding ability in a functional ELISA. Immobilized Human FCER1A at 2 μg/ml (100 μl/well). The concentration of Human IgE that produces 50% of the optimal binding response is found to be approximately 0.1 - 0.4 µg/ml. |
| Endotoxin | < 1.000 Eu/µg |
| SwissProt/Accession | P12319 |
| Gene | FCER1A |
| Residue | 26 to 205 |
| Sequence | VPQKPKVSLNPPWNRIFKGENVTLTCNGNNFFEVSSTKWFHNGSLSEETN SSLNIVNAKFEDSGEYKCQHQQVNESEPVYLEVFSDWLLLQASAEVVMEG QPLFLRCHGWRNWDVYKVIYYKDGEALKYWYENHNISITNATVEDSGTYY CTGKVWQLDYESEPLNITVIKAPREKYWLQ |
| Supplier Page | Shop |
Product images
SDS-PAGE analysis of reduced ab182693 stained overnight with Coomassie Blue.