Human Cytochrome C Oxidase subunit VIb full length protein
| Name | Human Cytochrome C Oxidase subunit VIb full length protein |
|---|---|
| Supplier | Abcam |
| Catalog | ab114917 |
| Category | Protein |
| Applications | WB SDS-PAGE ELISA |
| Species Reactivities | Human |
| Nature | Recombinant |
| Source | Wheat germ |
| SwissProt/Accession | P14854 |
| Gene | COX6B1 |
| Residue | 1 to 87 |
| Sequence | MAEDMETKIKNYKTAPFDSRFPNQNQTRNCWQNYLDFHRCQKAMTAKGGD ISVCEWYQRVYQSLCPTSWVTDWDEQRAEGTFPGKI |
| Supplier Page | Shop |
Product images
12.5% SDS-PAGE showing ab114917 at approximately 35.20kDa. Stained with Coomassie Blue.