Purity
Greater than 90% as determined by SDS-PAGE.
Research Area
Cardiovascular
Alternative Names
AE 1; AE1; Anion exchange protein 1; Anion exchanger 1; B3AT_HUMAN; Band 3 anion transport protein; Band 3; BND3; CD233; DI; Diego blood group; EMPB3; EPB3; Erythrocyte membrane protein band 3; Erythroid anion exchange protein; FR; Froese blood group; RTA1A; SLC4A1; Solute carrier family 4 anion exchanger member 1; Solute carrier family 4 member 1; SW; Swann blood group; Waldner blood group; WD; WD1; WR; Wright blood group
Species
Homo sapiens (Human)
Expression Region
1-403aa
Target Protein Sequence
MEELQDDYEDMMEENLEQEEYEDPDIPESQMEEPAAHDTEATATDYHTTSHPGTHKVYVELQELVMDEKNQELRWMEAARWVQLEENLGENGAWGRPHLSHLTFWSLLELRRVFTKGTVLLDLQETSLAGVANQLLDRFIFEDQIRPQDREELLRALLLKHSHAGELEALGGVKPAVLTRSGDPSQPLLPQHSSLETQLFCEQGDGGTEGHSPSGILEKIPPDSEATLVLVGRADFLEQPVLGFVRLQEAAELEAVELPVPIRFLFVLLGPEAPHIDYTQLGRAAATLMSERVFRIDAYMAQSRGELLHSLEGFLDCSLVLPPTDAPSEQALLSLVPVQRELLRRRYQSSPAKPDSSFYKGLDLNGGPDDPLQQTGQLFGGLVRDIRRRYPYYLSDITDAFSP
Note: The complete sequence including tag
sequence, target protein sequence and linker sequence could be provided upon request.
Tag Info
N-terminal 10xHis-tagged and C-terminal Myc-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that
we have in stock, however, if you have any special requirement for the format, please remark your
requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the
glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer,
6% Trehalose, pH 8.0.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw
cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature
and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized
form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description
The recombinant Human SLC4A1 protein is encoded by the gene of SLC4A1 (1-403aa). The gene of SLC4A1 was cloned in a system (E.coli) that supported the expression of SLC4A1. Modification of SLC4A1 by recombinant DNA technology could lead to the expression of the target protein. The protein was fused with N-terminal 10xHis tag & C-terminal Myc tag in the production. The purity is 90% determined by SDS-PAGE.
SLC4A1 is a protein coding gene that encodes Band 3 anion transport protein (Solute carrier family 4 member 1). According to some studies, SLC4A1 may have the following features.
The enhancer RNA lnc-SLC4A1-1 can apparently regulate unexplained recurrent pregnancy loss (URPL) by activating the CXCL8 and NF-kB pathways. A novel compound heterozygous SLC4A1 mutation in patients with autosomal recessive distal renal tubular acidosis in Thailand. The activity and distribution of carbonic anhydrase II in cells and its effect on the transport activity of anion exchanger AE1/SLC4A1. The molecular mechanism of autosomal dominant and recessive distal renal tubular acidosis caused by mutation of SLC4A1 (AE1). Two new SLC4A1 gene mutations were found in two unrelated Chinese families with distal renal tubular acidosis. A new variant of SLC4A1 in a family of autosomal dominant distal renal tubular acidosis with a severe phenotype.