Native Human IGF2
| Cat.No. : | IGF2-29116TH |
| Product Overview : | Human IGF-2. |
- Specification
- Gene Information
- Related Products
| Description : | This gene encodes a member of the insulin family of polypeptide growth factors, which are involved in development and growth. It is an imprinted gene, expressed only from the paternal allele, and epigenetic changes at this locus are associated with Wilms tumour, Beckwith-Wiedemann syndrome, rhabdomyosarcoma, and Silver-Russell syndrome. A read-through INS-IGF2 gene exists, whose 5 region overlaps the INS gene and the 3 region overlaps this gene. Alternatively spliced transcript variants encoding different isoforms have been found for this gene. |
| Form : | Liquid |
| Storage : | Store at +4°C short term (1-2 weeks). Aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles. |
| Sequences of amino acids : | Human IGF-2 is a 7.5 kDa protein containing 67 amino acid residues:AYRPSETLCGGELVDTLQFVCGDRGFYFSRPASRVSRRSRGIVEEC CFRSCDLALLETYCATPAKSE |
| Sequence Similarities : | Belongs to the insulin family. |
| Gene Name : | IGF2 insulin-like growth factor 2 (somatomedin A) [ Homo sapiens ] |
| Official Symbol : | IGF2 |
| Synonyms : | IGF2; insulin-like growth factor 2 (somatomedin A); C11orf43, chromosome 11 open reading frame 43; insulin-like growth factor II; FLJ44734; |
| Gene ID : | 3481 |
| mRNA Refseq : | NM_000612 |
| Protein Refseq : | NP_000603 |
| Uniprot ID : | P01344 |
| Chromosome Location : | 11p15.5 |
| Pathway : | Apoptosis, organism-specific biosystem; Diabetes pathways, organism-specific biosystem; Endochondral Ossification, organism-specific biosystem; Hedgehog Signaling Pathway, organism-specific biosystem; Regulation of Insulin-like Growth Factor (IGF) Activity by Insulin-like Growth Factor Binding Proteins (IGFBPs), organism-specific biosystem; |
| Function : | growth factor activity; hormone activity; insulin receptor binding; insulin-like growth factor receptor binding; protein binding; |
Products Types
| ◆ Recombinant Protein | ||
| Igf2-130M | Recombinant Active Mouse IGF2 Protein, His-tagged(N-ter) | +Inquiry |
| Igf2-44M | Active Recombinant Mouse Igf2 Protein (Ala25-Glu91), N-His tagged, Animal-free, Carrier-free | +Inquiry |
| IGF2-058H | Active Recombinant Human IGF2 Protein | +Inquiry |
| IGF2-5430H | Recombinant Human Insulin-Like Growth Factor 2 (somatomedin A) | +Inquiry |
| Igf2-1224M | Active Recombinant Mouse Igf2 Protein | +Inquiry |
| ◆ Native Protein | ||
| IGF2-621H | Native Human Insulin-Like Growth Factor 2 (somatomedin A) | +Inquiry |
| ◆ Lysates | ||
| IGF2-5266HCL | Recombinant Human IGF2 293 Cell Lysate | +Inquiry |
Related Gene
For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.
Inquiry
0
Inquiry Basket
