Recombinant Human ABCB1, His-tagged
Cat.No. : | ABCB1-30530TH |
Product Overview : | Recombinant fragment, corresponding to amino acids 1036-1280 of Human P Glycoprotein with N terminal His tag; Predicted MWt 28 kDa. |
- Specification
- Gene Information
- Related Products
- Download
Description : | The membrane-associated protein encoded by this gene is a member of the superfamily of ATP-binding cassette (ABC) transporters. ABC proteins transport various molecules across extra- and intra-cellular membranes. ABC genes are divided into seven distinct subfamilies (ABC1, MDR/TAP, MRP, ALD, OABP, GCN20, White). This protein is a member of the MDR/TAP subfamily. Members of the MDR/TAP subfamily are involved in multidrug resistance. The protein encoded by this gene is an ATP-dependent drug efflux pump for xenobiotic compounds with broad substrate specificity. It is responsible for decreased drug accumulation in multidrug-resistant cells and often mediates the development of resistance to anticancer drugs. This protein also functions as a transporter in the blood-brain barrier. |
Conjugation : | HIS |
Source : | E. coli |
Tissue specificity : | Expressed in liver, kidney, small intestine and brain. |
Form : | Lyophilised:Reconstitute with 37 μl aqua dest. |
Storage buffer : | Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5 |
Storage : | Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | TFGEVVFNYPTRPDIPVLQGLSLEVKKGQTLALVGSSGCG KSTVVQLLERFYDPLAGKVLLDGKEIKRLNVQWLRAHL GIVSQEPILFDCSIAENIAYGDNSRVVSQEEIVRAAKE ANIHAFIESLPNKYSTKVGDKGTQLSGGQKQRIAIARA LVRQPHILLLDEATSALDTESEKVVQEALDKAREGRTCIV IAHRLSTIQNADLIVVFQNGRVKEHGTHQQLLAQKGIY FSMVSVQAGTKRQ |
Sequence Similarities : | Belongs to the ABC transporter superfamily. ABCB family. Multidrug resistance exporter (TC 3.A.1.201) subfamily.Contains 2 ABC transmembrane type-1 domains.Contains 2 ABC transporter domains. |
Gene Name : | ABCB1 ATP-binding cassette, sub-family B (MDR/TAP), member 1 [ Homo sapiens ] |
Official Symbol : | ABCB1 |
Synonyms : | ABCB1; ATP-binding cassette, sub-family B (MDR/TAP), member 1; CLCS, colchicin sensitivity , MDR1, PGY1; multidrug resistance protein 1; ABC20; CD243; GP170; P gp; |
Gene ID : | 5243 |
mRNA Refseq : | NM_000927 |
Protein Refseq : | NP_000918 |
MIM : | 171050 |
Uniprot ID : | P08183 |
Chromosome Location : | 7q21.12 |
Pathway : | ABC transporters, organism-specific biosystem; ABC transporters, conserved biosystem; ABC-family proteins mediated transport, organism-specific biosystem; Bile secretion, organism-specific biosystem; Bile secretion, conserved biosystem; |
Function : | ATP binding; ATPase activity; ATPase activity, coupled to transmembrane movement of substances; hydrolase activity; nucleotide binding; |
Products Types
◆ Recombinant Protein | ||
ABCB1-2591H | Recombinant Human ABCB1 protein(381-660 aa), C-His-tagged | +Inquiry |
ABCB1-9C | Recombinant Cynomolgus Monkey ABCB1 Protein, His (Fc)-Avi-tagged | +Inquiry |
ABCB1-235H | Recombinant Human ABCB1 Protein, DDK-tagged | +Inquiry |
ABCB1-6R | Recombinant Rhesus Macaque ABCB1 Protein, His (Fc)-Avi-tagged | +Inquiry |
ABCB1-5275H | Recombinant Human ABCB1 protein, His-tagged | +Inquiry |
Related Gene
For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.
Inquiry
- Q&As
- Reviews
Q&As (11)
Ask a questionMany inhibitors can reverse ABCB1-mediated docetaxel resistance, different agents for different tumor, such as erastin in ovarian cancer.
In humans, ABCB1 genotyping in the treatment of depression rests on the assumption that genetic variations in ABCB1 explain individual differences in antidepressant response via their effects on P-gp expression at the blood-brain barrier.
Genetic variation in ABCB1 is associated with the pathogenesis of several dermatoses, including psoriasis, atopic dermatitis, melanoma, bullous pemphigoid, Behçet disease, and lichen planus.
Many agents could interact with ABCB1 including topical steroids, methotrexate, cyclosporine, azathioprine, antihistamines, antifungal agents, colchicine, tacrolimus, ivermectin, tetracycline, retinoid acids, and biologic agents.
There are large differences in the expression of P-glycoprotein in human liver, but this difference is not related to the C(3435)T and G(2677)T(A) polymorphisms in the ABCB1 gene.
Not only a nonpermissive chromatin structure (methylated) but either the absence of important transcriptional activators or the presence of repressors and co-repressors and the proteins like HDACs recruited by co-repressors can also inhibit gene transcription. The correlation between methylation and gene silencing for several genes are evidenced by researchers but many times there is absence of correlation observed for some genes too.
The convention is what is upstream of the downstream promoter is exon1a, and downstream of it, exon1b.
The human intestinal cell line Caco-2 has been reported to express,and cell lines such as MDCK and LLC-PK1 which have been transfected or transduced to overexpress ABCB1.
AMP-PNP, AMP-PCP, or ATP-gamma-S, but the required concentration will undoubtedly be quite high (mM).
Whether it is an artifact from nonspecific binding or a natural fragment of the target protein, the precise evaluation can be done by applying in-gel digestion followed by MS-based proteomic identification.
A related new study paper through recombinant mouse proteins has been published in the open access journal BioDiscovery, studying the second generation tyrosine kinase inhibitor (TKI) - dasatinib (DAS) and ATP binding (ABC) transport proteins ABCB1 and ABCG2 mechanism to assess whether these drug transporters may impair the therapeutic effect.
Ask a Question for All ABCB1 Products
Required fields are marked with *
My Review for All ABCB1 Products
Required fields are marked with *
Inquiry Basket