Recombinant Human ABCB1, His-tagged

Cat.No. : ABCB1-30530TH
Product Overview : Recombinant fragment, corresponding to amino acids 1036-1280 of Human P Glycoprotein with N terminal His tag; Predicted MWt 28 kDa.
  • Specification
  • Gene Information
  • Related Products
  • Download
Description : The membrane-associated protein encoded by this gene is a member of the superfamily of ATP-binding cassette (ABC) transporters. ABC proteins transport various molecules across extra- and intra-cellular membranes. ABC genes are divided into seven distinct subfamilies (ABC1, MDR/TAP, MRP, ALD, OABP, GCN20, White). This protein is a member of the MDR/TAP subfamily. Members of the MDR/TAP subfamily are involved in multidrug resistance. The protein encoded by this gene is an ATP-dependent drug efflux pump for xenobiotic compounds with broad substrate specificity. It is responsible for decreased drug accumulation in multidrug-resistant cells and often mediates the development of resistance to anticancer drugs. This protein also functions as a transporter in the blood-brain barrier.
Conjugation : HIS
Source : E. coli
Tissue specificity : Expressed in liver, kidney, small intestine and brain.
Form : Lyophilised:Reconstitute with 37 μl aqua dest.
Storage buffer : Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5
Storage : Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : TFGEVVFNYPTRPDIPVLQGLSLEVKKGQTLALVGSSGCG KSTVVQLLERFYDPLAGKVLLDGKEIKRLNVQWLRAHL GIVSQEPILFDCSIAENIAYGDNSRVVSQEEIVRAAKE ANIHAFIESLPNKYSTKVGDKGTQLSGGQKQRIAIARA LVRQPHILLLDEATSALDTESEKVVQEALDKAREGRTCIV IAHRLSTIQNADLIVVFQNGRVKEHGTHQQLLAQKGIY FSMVSVQAGTKRQ
Sequence Similarities : Belongs to the ABC transporter superfamily. ABCB family. Multidrug resistance exporter (TC 3.A.1.201) subfamily.Contains 2 ABC transmembrane type-1 domains.Contains 2 ABC transporter domains.
Gene Name : ABCB1 ATP-binding cassette, sub-family B (MDR/TAP), member 1 [ Homo sapiens ]
Official Symbol : ABCB1
Synonyms : ABCB1; ATP-binding cassette, sub-family B (MDR/TAP), member 1; CLCS, colchicin sensitivity , MDR1, PGY1; multidrug resistance protein 1; ABC20; CD243; GP170; P gp;
Gene ID : 5243
mRNA Refseq : NM_000927
Protein Refseq : NP_000918
MIM : 171050
Uniprot ID : P08183
Chromosome Location : 7q21.12
Pathway : ABC transporters, organism-specific biosystem; ABC transporters, conserved biosystem; ABC-family proteins mediated transport, organism-specific biosystem; Bile secretion, organism-specific biosystem; Bile secretion, conserved biosystem;
Function : ATP binding; ATPase activity; ATPase activity, coupled to transmembrane movement of substances; hydrolase activity; nucleotide binding;

For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.

Inquiry

  • Q&As
  • Reviews

Q&As (11)

Ask a question
What inhibitors could reverse the MDR of ABCB1? 04/14/2023

Many inhibitors can reverse ABCB1-mediated docetaxel resistance, different agents for different tumor, such as erastin in ovarian cancer.

Is ABCB1 a supplement treatment for depression? 04/14/2023

In humans, ABCB1 genotyping in the treatment of depression rests on the assumption that genetic variations in ABCB1 explain individual differences in antidepressant response via their effects on P-gp expression at the blood-brain barrier.

Does ABCB1 mutant could cause skin diseases? 04/14/2023

Genetic variation in ABCB1 is associated with the pathogenesis of several dermatoses, including psoriasis, atopic dermatitis, melanoma, bullous pemphigoid, Behçet disease, and lichen planus.

How many agents could interact with ABCB1? 04/14/2023

Many agents could interact with ABCB1 including topical steroids, methotrexate, cyclosporine, azathioprine, antihistamines, antifungal agents, colchicine, tacrolimus, ivermectin, tetracycline, retinoid acids, and biologic agents.

What's ther relationship between CT and GT(A) polymorphisms of ABCB1 gene and expression of human liver P-glycoprotein 04/14/2023

There are large differences in the expression of P-glycoprotein in human liver, but this difference is not related to the C(3435)T and G(2677)T(A) polymorphisms in the ABCB1 gene.

How do cancer cells still have ABCB1 protein expression although CpG islands in its promoters are mostly methylated? 04/14/2023

Not only a nonpermissive chromatin structure (methylated) but either the absence of important transcriptional activators or the presence of repressors and co-repressors and the proteins like HDACs recruited by co-repressors can also inhibit gene transcription. The correlation between methylation and gene silencing for several genes are evidenced by researchers but many times there is absence of correlation observed for some genes too.

What is the significance of dividing exon 1 into exon 1a and 1b at ABCB1 promoter region? 04/14/2023

The convention is what is upstream of the downstream promoter is exon1a, and downstream of it, exon1b.

Which cell line would be best to use as a positive control for the expression of ABCB1 and ABCG2? 04/14/2023

The human intestinal cell line Caco-2 has been reported to express,and cell lines such as MDCK and LLC-PK1 which have been transfected or transduced to overexpress ABCB1.

Are there any other compounds known to inhibit the ABCB1 ATPase apart from vanadate? 04/14/2023

AMP-PNP, AMP-PCP, or ATP-gamma-S, but the required concentration will undoubtedly be quite high (mM).

What is it? - 100KDa band from ABCB1 blot with human lung fibroblasts 04/14/2023

Whether it is an artifact from nonspecific binding or a natural fragment of the target protein, the precise evaluation can be done by applying in-gel digestion followed by MS-based proteomic identification.

How is the resistance of cancer cells affected by ABC-transporter? 04/14/2023

A related new study paper through recombinant mouse proteins has been published in the open access journal BioDiscovery, studying the second generation tyrosine kinase inhibitor (TKI) - dasatinib (DAS) and ATP binding (ABC) transport proteins ABCB1 and ABCG2 mechanism to assess whether these drug transporters may impair the therapeutic effect.

Customer Reviews (0)

Write a review

Ask a Question for All ABCB1 Products

Required fields are marked with *

My Review for All ABCB1 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon
logo

FOLLOW US

Terms and Conditions        Privacy Policy

Copyright © 2024 Creative BioMart. All Rights Reserved.

Contact Us

  • /

Stay Updated on the Latest Bioscience Trends