Creative BioMart to Present at
                        BIO-Europe Spring Creative BioMart to Present at IMMUNOLOGY2024™|May 3-7, 2024|Booth #512

Recombinant Human ATP4B

Cat.No. : ATP4B-29416TH
Product Overview : Recombinant fragment of Human Hydrogen Potassium ATPase Beta with a N terminal proprietary tag: predicted molecular weight 37.73 kDa inclusive of tag.
  • Specification
  • Gene Information
  • Related Products
  • Download
Description : The protein encoded by this gene belongs to a family of P-type cation-transporting ATPases. The gastric H+, K+-ATPase is a heterodimer consisting of a high molecular weight catalytic alpha subunit and a smaller but heavily glycosylated beta subunit. This enzyme is a proton pump that catalyzes the hydrolysis of ATP coupled with the exchange of H(+) and K(+) ions across the plasma membrane. It is also responsible for gastric acid secretion. This gene encodes the beta subunit of the gastric H+, K+-ATPase.
Protein length : 110 amino acids
Molecular Weight : 37.730kDa inclusive of tags
Source : Wheat germ
Form : Liquid
Purity : Proprietary Purification
Storage buffer : pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Storage : Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : DPYTPDYQDQLRSPGVTLRPDVYGEKGLEIVYNVSDNRTW ADLTQTLHAFLAGYSPAAQEDSINCTSEQYFFQESFRAPN HTKFSCKFTADMLQNCSGLADPNFGFEEGK
Gene Name : ATP4B ATPase, H+/K+ exchanging, beta polypeptide [ Homo sapiens ]
Official Symbol : ATP4B
Synonyms : ATP4B; ATPase, H+/K+ exchanging, beta polypeptide; potassium-transporting ATPase subunit beta; ATP6B;
Gene ID : 496
mRNA Refseq : NM_000705
Protein Refseq : NP_000696
MIM : 137217
Uniprot ID : P51164
Chromosome Location : 13q34
Pathway : Collecting duct acid secretion, organism-specific biosystem; Collecting duct acid secretion, conserved biosystem; Gastric acid secretion, organism-specific biosystem; Gastric acid secretion, conserved biosystem; Ion channel transport, organism-specific biosystem;
Function : hydrogen:potassium-exchanging ATPase activity; sodium:potassium-exchanging ATPase activity;

For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.

Inquiry

  • Q&As
  • Reviews

Q&As (6)

Ask a question
Are there any studies on drugs that regulate gastric acid secretion by ATP4B? 03/19/2020

Yes, several studies have been devoted to the development of drugs that can modulate ATP4B activity for the regulation of gastric acid secretion and the treatment of related gastric diseases.

What is the regulatory mechanism of ATP4B in gastric acid secretion? 10/30/2019

ATP4B regulates gastric acid secretion through ATP binding and ion pump transport, and the specific mechanism involves the regulation of a variety of signaling pathways and hormones.

Is the abnormal expression of ATP4B valuable in the diagnosis and prognosis of gastric-related diseases? 05/08/2019

The abnormal expression of ATP4B can be used as an important indicator for the diagnosis and prognosis of some gastric-related diseases, but it needs to be comprehensively analyzed in combination with other clinical and molecular biological results.

What other proteins does ATP4B interact with? 04/28/2019

Interacts with other proteins in the Parietal cells of the gastric mucosa, such as those associated with the parietal cells of the gastric mucosa, to jointly regulate the production and secretion of gastric acid.

What is the mutation mechanism of ATP4B? 04/02/2019

Mutations in ATP4B may lead to abnormal changes in its intracellular localization and function, and then affect the normal secretion of gastric acid.

Is the polymorphism of ATP4B gene associated with abnormal gastric acid? 02/07/2019

Yes, polymorphic variations in the ATP4B gene may be associated with the susceptibility and pathogenesis of gastric acid abnormalities, such as hyperacidity or hypoacidity.

Customer Reviews (2)

Write a review
Reviews
12/22/2022

    Their wide range of products can meet our needs in different research areas.

    10/13/2021

      ATP4B were highly reproducible and showed good process control and product quality.

      Ask a Question for All ATP4B Products

      Required fields are marked with *

      My Review for All ATP4B Products

      Required fields are marked with *

      0

      Inquiry Basket

      cartIcon
      logo

      FOLLOW US

      Terms and Conditions        Privacy Policy

      Copyright © 2024 Creative BioMart. All Rights Reserved.

      Contact Us

      • /

      Stay Updated on the Latest Bioscience Trends