Recombinant Human ATP4B
Cat.No. : | ATP4B-29416TH |
Product Overview : | Recombinant fragment of Human Hydrogen Potassium ATPase Beta with a N terminal proprietary tag: predicted molecular weight 37.73 kDa inclusive of tag. |
- Specification
- Gene Information
- Related Products
- Download
Description : | The protein encoded by this gene belongs to a family of P-type cation-transporting ATPases. The gastric H+, K+-ATPase is a heterodimer consisting of a high molecular weight catalytic alpha subunit and a smaller but heavily glycosylated beta subunit. This enzyme is a proton pump that catalyzes the hydrolysis of ATP coupled with the exchange of H(+) and K(+) ions across the plasma membrane. It is also responsible for gastric acid secretion. This gene encodes the beta subunit of the gastric H+, K+-ATPase. |
Protein length : | 110 amino acids |
Molecular Weight : | 37.730kDa inclusive of tags |
Source : | Wheat germ |
Form : | Liquid |
Purity : | Proprietary Purification |
Storage buffer : | pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | DPYTPDYQDQLRSPGVTLRPDVYGEKGLEIVYNVSDNRTW ADLTQTLHAFLAGYSPAAQEDSINCTSEQYFFQESFRAPN HTKFSCKFTADMLQNCSGLADPNFGFEEGK |
Gene Name : | ATP4B ATPase, H+/K+ exchanging, beta polypeptide [ Homo sapiens ] |
Official Symbol : | ATP4B |
Synonyms : | ATP4B; ATPase, H+/K+ exchanging, beta polypeptide; potassium-transporting ATPase subunit beta; ATP6B; |
Gene ID : | 496 |
mRNA Refseq : | NM_000705 |
Protein Refseq : | NP_000696 |
MIM : | 137217 |
Uniprot ID : | P51164 |
Chromosome Location : | 13q34 |
Pathway : | Collecting duct acid secretion, organism-specific biosystem; Collecting duct acid secretion, conserved biosystem; Gastric acid secretion, organism-specific biosystem; Gastric acid secretion, conserved biosystem; Ion channel transport, organism-specific biosystem; |
Function : | hydrogen:potassium-exchanging ATPase activity; sodium:potassium-exchanging ATPase activity; |
Products Types
◆ Recombinant Protein | ||
ATP4B-1337H | Recombinant Human ATP4B Protein (58-291 aa), His-tagged | +Inquiry |
ATP4B-522R | Recombinant Rat ATP4B Protein, His (Fc)-Avi-tagged | +Inquiry |
ATP4B-858M | Recombinant Mouse ATP4B Protein, His (Fc)-Avi-tagged | +Inquiry |
ATP4B-5988C | Recombinant Chicken ATP4B | +Inquiry |
Atp4b-490M | Recombinant Mouse Atp4b protein, His-tagged | +Inquiry |
◆ Lysates | ||
ATP4B-8607HCL | Recombinant Human ATP4B 293 Cell Lysate | +Inquiry |
Related Gene
For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.
Inquiry
- Q&As
- Reviews
Q&As (6)
Ask a questionYes, several studies have been devoted to the development of drugs that can modulate ATP4B activity for the regulation of gastric acid secretion and the treatment of related gastric diseases.
ATP4B regulates gastric acid secretion through ATP binding and ion pump transport, and the specific mechanism involves the regulation of a variety of signaling pathways and hormones.
The abnormal expression of ATP4B can be used as an important indicator for the diagnosis and prognosis of some gastric-related diseases, but it needs to be comprehensively analyzed in combination with other clinical and molecular biological results.
Interacts with other proteins in the Parietal cells of the gastric mucosa, such as those associated with the parietal cells of the gastric mucosa, to jointly regulate the production and secretion of gastric acid.
Mutations in ATP4B may lead to abnormal changes in its intracellular localization and function, and then affect the normal secretion of gastric acid.
Yes, polymorphic variations in the ATP4B gene may be associated with the susceptibility and pathogenesis of gastric acid abnormalities, such as hyperacidity or hypoacidity.
Customer Reviews (2)
Write a reviewTheir wide range of products can meet our needs in different research areas.
ATP4B were highly reproducible and showed good process control and product quality.
Ask a Question for All ATP4B Products
Required fields are marked with *
My Review for All ATP4B Products
Required fields are marked with *
Inquiry Basket