Recombinant Human BUB1B
Cat.No. : | BUB1B-26124TH |
Product Overview : | Recombinant fragment of Human BubR1 with a N terminal proprietary tag; predicted molecular weight 39.93 kDa. |
- Specification
- Gene Information
- Related Products
- Download
Description : | This gene encodes a kinase involved in spindle checkpoint function. The protein has been localized to the kinetochore and plays a role in the inhibition of the anaphase-promoting complex/cyclosome (APC/C), delaying the onset of anaphase and ensuring proper chromosome segregation. Impaired spindle checkpoint function has been found in many forms of cancer. |
Protein length : | 130 amino acids |
Molecular Weight : | 39.930kDa inclusive of tags |
Source : | Wheat germ |
Form : | Liquid |
Purity : | Proprietary Purification |
Storage buffer : | pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | MAAVKKEGGALSEAMSLEGDEWELSKENVQPLRQGRIMST LQGALAQESACNNTLQQQKRAFEYEIRFYTGNDPLDVWDR YISWTEQNYPQGGKESNMSTLLERAVEALQGEKRYYSDPR FLNLWLKLGR |
Gene Name : | BUB1B budding uninhibited by benzimidazoles 1 homolog beta (yeast) [ Homo sapiens ] |
Official Symbol : | BUB1B |
Synonyms : | BUB1B; budding uninhibited; budding uninhibited by benzimidazoles 1 (yeast homolog), beta; mitotic checkpoint serine/threonine-protein kinase BUB1 beta; Bub1A; BUBR1; MAD3L; SSK1; |
Gene ID : | 701 |
mRNA Refseq : | NM_001211 |
Protein Refseq : | NP_001202 |
MIM : | 602860 |
Uniprot ID : | O60566 |
Chromosome Location : | 15q15 |
Pathway : | APC/C-mediated degradation of cell cycle proteins, organism-specific biosystem; APC/C:Cdc20 mediated degradation of mitotic proteins, organism-specific biosystem; Activation of APC/C and APC/C:Cdc20 mediated degradation of mitotic proteins, organism-specific biosystem; Cell Cycle Checkpoints, organism-specific biosystem; Cell Cycle, Mitotic, organism-specific biosystem; |
Function : | ATP binding; nucleotide binding; protein binding; protein kinase activity; protein serine/threonine kinase activity; |
Products Types
◆ Recombinant Protein | ||
Bub1b-726M | Recombinant Mouse Bub1b Protein, MYC/DDK-tagged | +Inquiry |
BUB1B-27105TH | Recombinant Human BUB1B | +Inquiry |
BUB1B-5973C | Recombinant Chicken BUB1B | +Inquiry |
BUB1B-10335H | Recombinant Human BUB1B, GST-tagged | +Inquiry |
BUB1B-1371H | Active Recombinant Human BUB1B, GST-tagged | +Inquiry |
◆ Lysates | ||
BUB1B-8382HCL | Recombinant Human BUB1B 293 Cell Lysate | +Inquiry |
Related Gene
For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.
Inquiry
- Q&As
- Reviews
Q&As (0)
Ask a questionAsk a Question for All BUB1B Products
Required fields are marked with *
My Review for All BUB1B Products
Required fields are marked with *
0
Inquiry Basket