Recombinant Human CAPN2
| Cat.No. : | CAPN2-27400TH |
| Product Overview : | Recombinant full length Human Calpain 2 with N terminal proprietary tag; Predicted MWt 103.07. |
- Specification
- Gene Information
- Related Products
- Download
| Description : | The calpains, calcium-activated neutral proteases, are nonlysosomal, intracellular cysteine proteases. The mammalian calpains include ubiquitous, stomach-specific, and muscle-specific proteins. The ubiquitous enzymes consist of heterodimers with distinct large, catalytic subunits associated with a common small, regulatory subunit. This gene encodes the large subunit of the ubiquitous enzyme, calpain 2. Multiple heterogeneous transcriptional start sites in the 5 UTR have been reported. Two transcript variants encoding different isoforms have been found for this gene. |
| Protein length : | 700 amino acids |
| Molecular Weight : | 103.070kDa inclusive of tags |
| Source : | Wheat germ |
| Tissue specificity : | Ubiquitous. |
| Form : | Liquid |
| Purity : | Proprietary Purification |
| Storage buffer : | pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl |
| Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
| Sequences of amino acids : | MAGIAAKLAKDREAAEGLGSHERAIKYLNQDYEALRNECL EAGTLFQDPSFPAIPSALGFKELGPYSSKTRGIEWKRPTE ICADPQFIIGGATRTDICQGALGDCWLLAAIASLTLNEEI LARVVPLNQSFQENYAGIFHFQFWQYGEWVEVVVDDRLPT KDGELLFVHSAEGSEFWSALLEKAYAKINGCYEALSGGAT TEGFEDFTGGIAEWYELKKPPPNLFKIIQKALQKGSLLGC SIDITSAADSEAITFQKLVKGHAYSVTGAEEVESNGSLQK LIRIRNPWGEVEWTGRWNDNCPSWNTIDPEERERLTRRHE DGEFWMSFSDFLRHYSRLEICNLTPDTLTSDTYKKWKLTK MDGNWRRGSTAGGCRNYPNTFWMNPQYLIKLEEEDEDEED GESGCTFLVGLIQKHRRRQRKMGEDMHTIGFGIYEVPEEL SGQTNIHLSKNFFLTNRARERSDTFINLREVLNRFKLPPG EYILVPSTFEPNKDGDFCIRVFSEKKADYQAVDDEIEANL EEFDISEDDIDDGFRRLFAQLAGEDAEISAFELQTILRRV LAKRQDIKSDGFSIETCKIMVDMLDSDGSGKLGLKEFYIL WTKIQKYQKIYREIDVDRSGTMNSYEMRKALEEAGFKMPC QLHQVIVARFADDQLIIDFDNFVRCLVRLETLFKIFKQLD PENTGTIELDLISWLCFSVL |
| Sequence Similarities : | Belongs to the peptidase C2 family.Contains 1 calpain catalytic domain.Contains 3 EF-hand domains. |
| Gene Name : | CAPN2 calpain 2, (m/II) large subunit [ Homo sapiens ] |
| Official Symbol : | CAPN2 |
| Synonyms : | CAPN2; calpain 2, (m/II) large subunit; calpain-2 catalytic subunit; CANPL2; CANPml; mCANP; |
| Gene ID : | 824 |
| mRNA Refseq : | NM_001146068 |
| Protein Refseq : | NP_001139540 |
| MIM : | 114230 |
| Uniprot ID : | P17655 |
| Chromosome Location : | 1q41-q42 |
| Pathway : | Alzheimers disease, organism-specific biosystem; Alzheimers disease, conserved biosystem; Apoptosis, organism-specific biosystem; Apoptosis, conserved biosystem; ErbB1 downstream signaling, organism-specific biosystem; |
| Function : | calcium ion binding; calcium-dependent cysteine-type endopeptidase activity; cysteine-type peptidase activity; cytoskeletal protein binding; peptidase activity; |
Products Types
| ◆ Recombinant Protein | ||
| Capn2-759M | Recombinant Mouse Capn2 Protein, MYC/DDK-tagged | +Inquiry |
| CAPN2-453R | Recombinant Rhesus Macaque CAPN2 Protein, His (Fc)-Avi-tagged | +Inquiry |
| Capn2-362M | Recombinant Mouse Capn2 Protein, GST-tagged | +Inquiry |
| CAPN2-1216M | Recombinant Mouse CAPN2 Protein, His (Fc)-Avi-tagged | +Inquiry |
| CAPN2-0363H | Recombinant Human CAPN2 Protein, GST-Tagged | +Inquiry |
| ◆ Native Protein | ||
| CAPN2-22P | Active Native Porcine CAPN2 protein | +Inquiry |
| CAPN2-350B | Native Bovine CAPN2 | +Inquiry |
| ◆ Lysates | ||
| CAPN2-7863HCL | Recombinant Human CAPN2 293 Cell Lysate | +Inquiry |
Related Gene
For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.
Inquiry
- Q&As
- Reviews
Q&As (5)
Ask a questionCAPN2 activity is tightly regulated by intracellular calcium levels and various other factors to maintain cellular homeostasis.
CAPN2 interacts with various cellular proteins, contributing to processes like protein degradation, cytoskeletal remodeling, and cell signaling, influencing disease pathways.
Research suggests that modulating CAPN2 activity could be a potential therapeutic strategy for managing diseases associated with its dysregulation.
Some compounds and inhibitors targeting CAPN2 have been developed in preclinical studies, showing promise in controlling its activity for therapeutic purposes.
In some cases, altered levels of CAPN2 have been observed in disease states, suggesting its potential as a biomarker, but further validation is needed.
Customer Reviews (3)
Write a reviewThe CAPN2 protein has been extensively studied and validated in various experimental applications.
Their team of technical experts possess deep knowledge and expertise regarding the protein, ensuring that researchers receive accurate and timely assistance.
In addition to its advantages in trials, the manufacturer of the CAPN2 protein offers exceptional support to researchers.
Ask a Question for All CAPN2 Products
Required fields are marked with *
My Review for All CAPN2 Products
Required fields are marked with *
Inquiry Basket
