Recombinant Human CD1D
| Cat.No. : | CD1D-27107TH |
| Product Overview : | Recombinant full length Human CD1d with N terminal proprietary tag; predicted MW 62.59 kDa. |
- Specification
- Gene Information
- Related Products
- Download
| Description : | This gene encodes a divergent member of the CD1 family of transmembrane glycoproteins, which are structurally related to the major histocompatibility complex (MHC) proteins and form heterodimers with beta-2-microglobulin. The CD1 proteins mediate the presentation of primarily lipid and glycolipid antigens of self or microbial origin to T cells. The human genome contains five CD1 family genes organized in a cluster on chromosome 1. The CD1 family members are thought to differ in their cellular localization and specificity for particular lipid ligands. The protein encoded by this gene localizes to late endosomes and lysosomes via a tyrosine-based motif in the cytoplasmic tail. |
| Protein length : | 335 amino acids |
| Molecular Weight : | 62.590kDa inclusive of tags |
| Source : | Wheat germ |
| Tissue specificity : | Expressed on cortical thymocytes, on certain T-cell leukemias, and in various other tissues. |
| Form : | Liquid |
| Purity : | Proprietary Purification |
| Storage buffer : | pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl |
| Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
| Sequences of amino acids : | MGCLLFLLLWALLQAWGSAEVPQRLFPLRCLQISSFANSS WTRTDGLAWLGELQTHSWSNDSDTVRSLKPWSQGTFSDQQ WETLQHIFRVYRSSFTRDVKEFAKMLRLSYPLELQVSAGC EVHPGNASNNFFHVAFQGKDILSFQGTSWEPTQEAPLWVN LAIQVLNQDKWTRETVQWLLNGTCPQFVSGLLESGKSELK KQVKPKAWLSRGPSPGPGRLLLVCHVSGFYPKPVWVKWMR GEQEQQGTQPGDILPNADETWYLRATLDVVAGEAAGLSCR VKHSSLEGQDIVLYWGGSYTSMGLIALAVLACLLFLLIVG FTSRFKRQTSYQGVL |
| Sequence Similarities : | Contains 1 Ig-like (immunoglobulin-like) domain. |
| Gene Name : | CD1D CD1d molecule [ Homo sapiens ] |
| Official Symbol : | CD1D |
| Synonyms : | CD1D; CD1d molecule; CD1d antigen , CD1D antigen, d polypeptide; antigen-presenting glycoprotein CD1d; |
| Gene ID : | 912 |
| mRNA Refseq : | NM_001766 |
| Protein Refseq : | NP_001757 |
| MIM : | 188410 |
| Uniprot ID : | P15813 |
| Chromosome Location : | 1q22-q23 |
| Pathway : | Amoebiasis, organism-specific biosystem; Amoebiasis, conserved biosystem; Hematopoietic cell lineage, organism-specific biosystem; Hematopoietic cell lineage, conserved biosystem; |
| Function : | beta-2-microglobulin binding; exogenous lipid antigen binding; histone binding; receptor activity; |
Products Types
| ◆ Recombinant Protein | ||
| CD1D-231H | Recombinant Human CD1D Protein, His-tagged | +Inquiry |
| CD1D-166H | Recombinant Human CD1D Protein, C-His-tagged | +Inquiry |
| CD1D-550R | Recombinant Rhesus Macaque CD1D Protein, His (Fc)-Avi-tagged | +Inquiry |
| CD1D-723R | Recombinant Rhesus monkey CD1D Protein, His-tagged | +Inquiry |
| CD1d-0916H | Recombinant Human CD1d Protein (Glu20-Ser301), N-His tagged | +Inquiry |
| ◆ Lysates | ||
| CD1D-2479HCL | Recombinant Human CD1D cell lysate | +Inquiry |
Related Gene
For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.
Inquiry
- Q&As
- Reviews
Q&As (5)
Ask a questionSome pharmaceutical companies are researching and developing drugs that target CD1D for therapeutic purposes, although these are still in the early stages of development.
CD1D binds and presents lipid antigens to NKT cells, facilitating immune responses against pathogens or aberrant cells.
CD1D primarily presents lipid antigens, while major histocompatibility complex (MHC) proteins present peptide antigens. CD1D is crucial for lipid-specific immune responses.
CD1D deficiency has been associated with an increased susceptibility to certain infections and a potential link to autoimmune disorders.
Yes, several clinical trials are exploring the modulation of CD1D in various diseases, including cancer and autoimmune disorders, to assess its therapeutic potential.
Customer Reviews (3)
Write a reviewThe CD1D protein's versatility allows it to be effectively employed in various experimental designs, further enhancing its suitability for diverse research needs.
Their extensive knowledge and expertise can help troubleshoot issues or provide guidance on experimental design, enabling you to overcome obstacles and achieve your research goals.
In protein electron microscopy structure analysis, the CD1D protein demonstrates outstanding performance.
Ask a Question for All CD1D Products
Required fields are marked with *
My Review for All CD1D Products
Required fields are marked with *
Inquiry Basket
