Recombinant Human DAD1

Cat.No. : DAD1-27092TH
Product Overview : Recombinant full length Human DAD1 with N terminal proprietary tag, 38.17 kDa.
Unit
Price
Qty
  • Specification
  • Gene Information
  • Related Products
  • Download
Description : DAD1, the defender against apoptotic cell death, was initially identified as a negative regulator of programmed cell death in the temperature sensitive tsBN7 cell line.The DAD1 protein disappeared in temperature-sensitive cells following a shift to the nonpermissive temperature, suggesting that loss of the DAD1 protein triggered apoptosis.DAD1 is believed to be a tightly associated subunit of oligosaccharyltransferase both in the intact membrane and in the purified enzyme, thus reflecting the essential nature of N-linked glycosylation in eukaryotes.
Protein length : 113 amino acids
Molecular Weight : 38.170kDa inclusive of tags
Source : Wheat germ
Form : Liquid
Purity : Proprietary Purification
Storage buffer : pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Storage : Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : MSASVVSVISRFLEEYLSSTPQRLKLLDAYLLYILLTGAL QFGYCLLVGTFPFNSFLSGFISCVGSFILAVCLRIQINPQ NKADFQGISPERAFADFLFASTILHLVVMNFVG
Sequence Similarities : Belongs to the DAD/OST2 family.
Gene Name : DAD1 defender against cell death 1 [ Homo sapiens ]
Official Symbol : DAD1
Synonyms : DAD1; defender against cell death 1; dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit DAD1; oligosaccharyltransferase 2 homolog (S. cerevisiae); OST2;
Gene ID : 1603
mRNA Refseq : NM_001344
Protein Refseq : NP_001335
MIM : 600243
Uniprot ID : P61803
Chromosome Location : 14q11.2
Pathway : Asparagine N-linked glycosylation, organism-specific biosystem; Metabolic pathways, organism-specific biosystem; Metabolism of proteins, organism-specific biosystem; N-Glycan biosynthesis, organism-specific biosystem; N-Glycan biosynthesis, conserved biosystem;
Function : contributes_to dolichyl-diphosphooligosaccharide-protein glycotransferase activity; contributes_to oligosaccharyl transferase activity; transferase activity;

For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.

Inquiry

  • Q&As
  • Reviews

Q&As (0)

Ask a question

Customer Reviews (0)

Write a review

Ask a Question for All DAD1 Products

Required fields are marked with *

My Review for All DAD1 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon
logo

FOLLOW US

Terms and Conditions        Privacy Policy

Copyright © 2024 Creative BioMart. All Rights Reserved.

Contact Us

  • /

Stay Updated on the Latest Bioscience Trends