Recombinant Human IDH2, His-tagged
Cat.No. : | IDH2-28080TH |
Product Overview : | Recombinant fragment, corresponding to amino acids 217-442 of Human IDH2 with an N terminal His tag; MWt 26 kDa. |
- Specification
- Gene Information
- Related Products
- Download
Description : | Isocitrate dehydrogenases catalyze the oxidative decarboxylation of isocitrate to 2-oxoglutarate. These enzymes belong to two distinct subclasses, one of which utilizes NAD(+) as the electron acceptor and the other NADP(+). Five isocitrate dehydrogenases have been reported: three NAD(+)-dependent isocitrate dehydrogenases, which localize to the mitochondrial matrix, and two NADP(+)-dependent isocitrate dehydrogenases, one of which is mitochondrial and the other predominantly cytosolic. Each NADP(+)-dependent isozyme is a homodimer. The protein encoded by this gene is the NADP(+)-dependent isocitrate dehydrogenase found in the mitochondria. It plays a role in intermediary metabolism and energy production. This protein may tightly associate or interact with the pyruvate dehydrogenase complex. |
Conjugation : | HIS |
Source : | E. coli |
Form : | Lyophilised:Reconstitute with 87 μl aqua dest. |
Storage buffer : | Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5 |
Storage : | Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | VGMGMYNTDESISGFAHSCFQYAIQKKWPLYMSTKNTILK AYDGRFKDIFQEIFDKHYKTDFDKNKIWYEHRLIDDMV AQVLKSSGGFVWACKNYDGDVQSDILAQGFGSLGLMTS VLVCPDGKTIEAEAAHGTVTRHYREHQKGRPTSTNPIA SIFAWTRGLEHRGKLDGNQDLIRFAQMLEKVCVETVESGA MTKDLAGCIHGLSNVKLNEHFLNTTDFLDTIK |
Sequence Similarities : | Belongs to the isocitrate and isopropylmalate dehydrogenases family. |
Gene Name : | IDH2 isocitrate dehydrogenase 2 (NADP+), mitochondrial [ Homo sapiens ] |
Official Symbol : | IDH2 |
Synonyms : | IDH2; isocitrate dehydrogenase 2 (NADP+), mitochondrial; isocitrate dehydrogenase [NADP], mitochondrial; |
Gene ID : | 3418 |
mRNA Refseq : | NM_002168 |
Protein Refseq : | NP_002159 |
MIM : | 147650 |
Uniprot ID : | P48735 |
Chromosome Location : | 15q21-qter |
Pathway : | Citrate cycle (TCA cycle), organism-specific biosystem; Citrate cycle (TCA cycle), conserved biosystem; Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate, organism-specific biosystem; Citrate cycle, first carbon oxidation, oxaloacetate => |
Function : | NAD binding; isocitrate dehydrogenase (NADP+) activity; isocitrate dehydrogenase (NADP+) activity; magnesium ion binding; oxidoreductase activity; |
Products Types
◆ Recombinant Protein | ||
IDH2-4410M | Recombinant Mouse IDH2 Protein, His (Fc)-Avi-tagged | +Inquiry |
IDH2-2641R | Recombinant Rat IDH2 Protein, His (Fc)-Avi-tagged | +Inquiry |
IDH2-355C | Recombinant Cynomolgus Monkey IDH2 Protein, His (Fc)-Avi-tagged | +Inquiry |
IDH2-1135H | Recombinant Human IDH2 Protein, His (Fc)-Avi-tagged | +Inquiry |
IDH2-2013R | Recombinant Rhesus Macaque IDH2 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Lysates | ||
IDH2-5306HCL | Recombinant Human IDH2 293 Cell Lysate | +Inquiry |
Related Gene
For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.
Inquiry
- Q&As
- Reviews
Q&As (0)
Ask a questionAsk a Question for All IDH2 Products
Required fields are marked with *
My Review for All IDH2 Products
Required fields are marked with *
0
Inquiry Basket