Creative BioMart to Present at
                        BIO-Europe Spring Creative BioMart to Present at IMMUNOLOGY2024™|May 3-7, 2024|Booth #512

Recombinant Human IDH3A

Cat.No. : IDH3A-28925TH
Product Overview : Recombinant full length Human IDH3A with N-terminal proprietary tag. Mol Wt 66 kDa inclusive of tag.
  • Specification
  • Gene Information
  • Related Products
  • Download
Description : Isocitrate dehydrogenases catalyze the oxidative decarboxylation of isocitrate to 2-oxoglutarate. These enzymes belong to two distinct subclasses, one of which utilizes NAD(+) as the electron acceptor and the other NADP(+). Five isocitrate dehydrogenases have been reported: three NAD(+)-dependent isocitrate dehydrogenases, which localize to the mitochondrial matrix, and two NADP(+)-dependent isocitrate dehydrogenases, one of which is mitochondrial and the other predominantly cytosolic. NAD(+)-dependent isocitrate dehydrogenases catalyze the allosterically regulated rate-limiting step of the tricarboxylic acid cycle. Each isozyme is a heterotetramer that is composed of two alpha subunits, one beta subunit, and one gamma subunit. The protein encoded by this gene is the alpha subunit of one isozyme of NAD(+)-dependent isocitrate dehydrogenase.
Protein length : 366 amino acids
Molecular Weight : 66.000kDa
Source : Wheat germ
Form : Liquid
Purity : Proprietary Purification
Storage buffer : pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Storage : Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : MAGPAWISKVSRLLGAFHNPKQVTRGFTGGVQTVTLIPGD GIGPEISAAVMKIFDAAKAPIQWEERNVTAIQGPGGKWMI PSEAKESMDKNKMGLKGPLKTPIAAGHPSMNLLLRKTFDL YANVRPCVSIEGYKTPYTDVNIVTIRENTEGEYSGIEHVI VDGVVQSIKLITEGASKRIAEFAFEYARNNHRSNVTAVHK ANIMRMSDGLFLQKCREVAESCKDIKFNEMYLDTVCLNMV QDPSQFDVLVMPNLYGDILSDLCAGLIGGLGVTPSGNIGA NGVAIFESVHGTAPDIAGKDMANPTALLLSAVMMLRHMGL FDHAARIEAACFATIKDGKSLTKDLGGNAKCSDFTEEICR RVKDLD
Sequence Similarities : Belongs to the isocitrate and isopropylmalate dehydrogenases family.
Gene Name : IDH3A isocitrate dehydrogenase 3 (NAD+) alpha [ Homo sapiens ]
Official Symbol : IDH3A
Synonyms : IDH3A; isocitrate dehydrogenase 3 (NAD+) alpha; isocitrate dehydrogenase [NAD] subunit alpha, mitochondrial; H IDH alpha; isocitrate dehydrogenase (NAD+) alpha chain; isocitrate dehydrogenase [NAD] subunit alpha; mitochondrial; isocitric dehydrogenase; NA
Gene ID : 3419
mRNA Refseq : NM_005530
Protein Refseq : NP_005521
MIM : 601149
Uniprot ID : P50213
Chromosome Location : 15q25.1-q25.2
Pathway : Citrate cycle (TCA cycle), organism-specific biosystem; Citrate cycle (TCA cycle), conserved biosystem; Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate, organism-specific biosystem; Citrate cycle, first carbon oxidation, oxaloacetate =>
Function : NAD binding; isocitrate dehydrogenase (NAD+) activity; magnesium ion binding; oxidoreductase activity; oxidoreductase activity, acting on the CH-OH group of donors, NAD or NADP as acceptor;

For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.

Inquiry

  • Q&As
  • Reviews

Q&As (0)

Ask a question

Customer Reviews (0)

Write a review

Ask a Question for All IDH3A Products

Required fields are marked with *

My Review for All IDH3A Products

Required fields are marked with *

0

Inquiry Basket

cartIcon
logo

FOLLOW US

Terms and Conditions        Privacy Policy

Copyright © 2024 Creative BioMart. All Rights Reserved.

Contact Us

  • /

Stay Updated on the Latest Bioscience Trends