Recombinant Human IDH3G
Cat.No. : | IDH3G-28079TH |
Product Overview : | Recombinant full length Human IDH3G with N terminal proprietary tag; Predicted MWt 69.34 kDa. |
- Specification
- Gene Information
- Related Products
- Download
Description : | Isocitrate dehydrogenases catalyze the oxidative decarboxylation of isocitrate to 2-oxoglutarate. These enzymes belong to two distinct subclasses, one of which utilizes NAD(+) as the electron acceptor and the other NADP(+). Five isocitrate dehydrogenases have been reported: three NAD(+)-dependent isocitrate dehydrogenases, which localize to the mitochondrial matrix, and two NADP(+)-dependent isocitrate dehydrogenases, one of which is mitochondrial and the other predominantly cytosolic. NAD(+)-dependent isocitrate dehydrogenases catalyze the allosterically regulated rate-limiting step of the tricarboxylic acid cycle. Each isozyme is a heterotetramer that is composed of two alpha subunits, one beta subunit, and one gamma subunit. The protein encoded by this gene is the gamma subunit of one isozyme of NAD(+)-dependent isocitrate dehydrogenase. This gene is a candidate gene for periventricular heterotopia. Several alternatively spliced transcript variants of this gene have been described, but only some of their full length natures have been determined. |
Protein length : | 393 amino acids |
Molecular Weight : | 69.340kDa inclusive of tags |
Source : | Wheat germ |
Form : | Liquid |
Purity : | Proprietary Purification |
Storage buffer : | pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | MALKVATVAGSAAKAVLGPALLCRPWEVLGAHEVPSRNIF SEQTIPPSAKYGGRHTVTMIPGDGIGPELMLHVKSVFRHA CVPVDFEEVHVSSNADEEDIRNAIMAIRRNRVALKGNIET NHNLPPSHKSRNNILRTSLDLYANVIHCKSLPGVVTRHKD IDILIVRENTEGEYSSLEHESVAGVVESLKIITKAKSLRI AEYAFKLAQESGRKKVTAVHKANIMKLGDGLFLQCCREVA ARYPQITFENMIVDNTTMQLVSRPQQFDVMVMPNLYGNIV NNVCAGLVGGPGLVAGANYGHVYAVFETATRNTGKSIANK NIANPTATLLASCMMLDHLKLHSYAASIRKAVLASMDNEN MHTPDIGGQGTTSEAIQDVIRHIRVINGRAVEA |
Sequence Similarities : | Belongs to the isocitrate and isopropylmalate dehydrogenases family. |
Gene Name : | IDH3G isocitrate dehydrogenase 3 (NAD+) gamma [ Homo sapiens ] |
Official Symbol : | IDH3G |
Synonyms : | IDH3G; isocitrate dehydrogenase 3 (NAD+) gamma; isocitrate dehydrogenase [NAD] subunit gamma, mitochondrial; |
Gene ID : | 3421 |
mRNA Refseq : | NM_004135 |
Protein Refseq : | NP_004126 |
MIM : | 300089 |
Uniprot ID : | P51553 |
Chromosome Location : | Xq28 |
Pathway : | Citrate cycle (TCA cycle), organism-specific biosystem; Citrate cycle (TCA cycle), conserved biosystem; Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate, organism-specific biosystem; Citrate cycle, first carbon oxidation, oxaloacetate => |
Function : | ATP binding; NAD binding; isocitrate dehydrogenase (NAD+) activity; magnesium ion binding; oxidoreductase activity; |
Products Types
◆ Recombinant Protein | ||
IDH3G-4412M | Recombinant Mouse IDH3G Protein, His (Fc)-Avi-tagged | +Inquiry |
IDH3G-3064H | Recombinant Human IDH3G protein, His-SUMO-tagged | +Inquiry |
IDH3G-28927TH | Recombinant Human IDH3G, His-tagged | +Inquiry |
IDH3G-2471Z | Recombinant Zebrafish IDH3G | +Inquiry |
IDH3G-7988M | Recombinant Mouse IDH3G Protein | +Inquiry |
◆ Lysates | ||
IDH3G-5302HCL | Recombinant Human IDH3G 293 Cell Lysate | +Inquiry |
IDH3G-5303HCL | Recombinant Human IDH3G 293 Cell Lysate | +Inquiry |
Related Gene
For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.
Inquiry
- Q&As
- Reviews
Q&As (0)
Ask a questionAsk a Question for All IDH3G Products
Required fields are marked with *
My Review for All IDH3G Products
Required fields are marked with *
0
Inquiry Basket