Creative BioMart to Present at
                        BIO-Europe Spring Creative BioMart to Present at IMMUNOLOGY2024™|May 3-7, 2024|Booth #512

Recombinant Human PLCB3, His-tagged

Cat.No. : PLCB3-27922TH
Product Overview : Recombinant fragment, corresponding to amino acids 1021-1234 of Human Phospholipase C beta 3 with an N terminal His tag. Predicted MWt: 26 kDa;
  • Specification
  • Gene Information
  • Related Products
  • Download
Description : This gene encodes a member of the phosphoinositide phospholipase C beta enzyme family that catalyze the production of the secondary messengers diacylglycerol and inositol 1,4,5-triphosphate from phosphatidylinositol in G-protein-linked receptor-mediated signal transduction. Alternative splicing results in multiple transcript variants.
Conjugation : HIS
Source : E. coli
Form : Lyophilised:Reconstitute with 165 μl aqua dest.
Storage buffer : Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5
Storage : Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : TKEGEDEAKRYQEFQNRQVQSLLELREAQVDAEAQRRLEH LRQALQRLREVVLDANTTQFKRLKEMNEREKKELQKIL DRKRHNSISEAKMRDKHKKEAELTEINRRHITESVNSI RRLEEAQKQRHDRLVAGQQQVLQQLAEEEPKLLAQLAQEC QEQRARLPQEIRRSLLGEMPEGLGDGPLVACASNGHAP GSSGHLSGADSESQEENTQL
Gene Name : PLCB3 phospholipase C, beta 3 (phosphatidylinositol-specific) [ Homo sapiens ]
Official Symbol : PLCB3
Synonyms : PLCB3; phospholipase C, beta 3 (phosphatidylinositol-specific); 1-phosphatidylinositol-4,5-bisphosphate phosphodiesterase beta-3;
Gene ID : 5331
mRNA Refseq : NM_000932
Protein Refseq : NP_000923
MIM : 600230
Uniprot ID : Q01970
Chromosome Location : 11q13
Pathway : Activation of Kainate Receptors upon glutamate binding, organism-specific biosystem; African trypanosomiasis, organism-specific biosystem; African trypanosomiasis, conserved biosystem; Alzheimers disease, organism-specific biosystem; Alzheimers disease, conserved biosystem;
Function : calcium ion binding; calmodulin binding; hydrolase activity; phosphatidylinositol phospholipase C activity; phospholipase C activity;

For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.

Inquiry

  • Q&As
  • Reviews

Q&As (0)

Ask a question

Customer Reviews (0)

Write a review

Ask a Question for All PLCB3 Products

Required fields are marked with *

My Review for All PLCB3 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon
logo

FOLLOW US

Terms and Conditions        Privacy Policy

Copyright © 2024 Creative BioMart. All Rights Reserved.

Contact Us

  • /

Stay Updated on the Latest Bioscience Trends