Creative BioMart to Present at
                        BIO-Europe Spring Creative BioMart to Present at IMMUNOLOGY2024™|May 3-7, 2024|Booth #512

Recombinant Human SDHB, His-tagged

Cat.No. : SDHB-31392TH
Product Overview : Recombinant full length protein, corresponding to amino acids 1-280 of Human SDHB with N terminal His tag, MWt 35kDa.
  • Specification
  • Gene Information
  • Related Products
  • Download
Description : Complex II of the respiratory chain, which is specifically involved in the oxidation of succinate, carries electrons from FADH to CoQ. The complex is composed of four nuclear-encoded subunits and is localized in the mitochondrial inner membrane. The iron-sulfur subunit is highly conserved and contains three cysteine-rich clusters which may comprise the iron-sulfur centers of the enzyme. Sporadic and familial mutations in this gene result in paragangliomas and pheochromocytoma, and support a link between mitochondrial dysfunction and tumorigenesis.
Conjugation : HIS
Source : E. coli
Form : Lyophilised:Reconstitute with 96 μl aqua dest.
Storage buffer : Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5
Storage : Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : MAAVVALSLRRRLPATTLGGACLQASRGAQTAAATAPRIK KFAIYRWDPDKAGDKPHMQTYEVDLNKCGPMVLDALIK IKNEVDSTLTFRRSCREGICGSCAMNINGGNTLACTRR IDTNLNKVSKIYPLPHMYVIKDLVPDLSNFYAQYKSIE PYLKKKDESQEGKQQYLQSIEEREKLDGLYECILCACCST SCPSYWWNGDKYLGPAVLMQAYRWMIDSRDDFTEERLA KLQDPFSLYRCHTIMNCTRTCPKGLNPGKAIAEIKKMM ATYKEKKASV
Sequence Similarities : Belongs to the succinate dehydrogenase/fumarate reductase iron-sulfur protein family.Contains 1 2Fe-2S ferredoxin-type domain.Contains 1 4Fe-4S ferredoxin-type domain.
Gene Name : SDHB succinate dehydrogenase complex, subunit B, iron sulfur (Ip) [ Homo sapiens ]
Official Symbol : SDHB
Synonyms : SDHB; succinate dehydrogenase complex, subunit B, iron sulfur (Ip); SDH, SDH1; succinate dehydrogenase [ubiquinone] iron-sulfur subunit, mitochondrial;
Gene ID : 6390
mRNA Refseq : NM_003000
Protein Refseq : NP_002991
MIM : 185470
Uniprot ID : P21912
Chromosome Location : 1p36.1-p35
Pathway : Alzheimers disease, organism-specific biosystem; Alzheimers disease, conserved biosystem; Citrate cycle (TCA cycle), organism-specific biosystem; Citrate cycle (TCA cycle), conserved biosystem; Citrate cycle, second carbon oxidation, 2-oxoglutarate =>
Function : 2 iron, 2 sulfur cluster binding; 3 iron, 4 sulfur cluster binding; 4 iron, 4 sulfur cluster binding; electron carrier activity; metal ion binding;

For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.

Inquiry

  • Q&As
  • Reviews

Q&As (0)

Ask a question

Customer Reviews (0)

Write a review

Ask a Question for All SDHB Products

Required fields are marked with *

My Review for All SDHB Products

Required fields are marked with *

0

Inquiry Basket

cartIcon
logo

FOLLOW US

Terms and Conditions        Privacy Policy

Copyright © 2024 Creative BioMart. All Rights Reserved.

Contact Us

  • /

Stay Updated on the Latest Bioscience Trends