As to your request for the antigen of DRB3, please check detailed information as follows:
We can provide all of these antigens expressed by our four expression systems: E.coli, Yeast, Baculovirus and Mammalian Cell, please check and confirm which expression system you need.
DRB3
Recombinant Human HLA class II histocompatibility antigen, DR beta 3 chain(HLA-DRB3),partial
CSB-YP302920HU >> Yeast
CSB-EP302920HU >> E.coli
CSB-BP302920HU >> Baculovirus
CSB-MP302920HU >> Mammalian cell
Expression Region:30-227aa; Partial, provide the complete extracellular domain.
Tag information:Tag type will be determined during the manufacturing process.
The expected tag for each expression system is listed as follows: YP: N-terminal 6xHis-tagged; EP, BP, MP: N-terminal 10xHis-tagged and C-terminal Myc-tagged.
Sequence:
GDTRPRFLELRKSECHFFNGTERVRYLDRYFHNQEEFLRFDSDVGEYRAVTELGRPVAESWNSQKDLLEQKRGRVDNYCRHNYGVGESFTVQRRVHPQVTVYPAKTQPLQHHNLLVCSVSGFYPGSIEVRWFRNGQEEKAGVVSTGLIQNGDWTFQTLVMLETVPRSGEVYTCQVEHPSVTSALTVEWRARSESAQSK