| Name | A1CF antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-4770 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human, Mouse, Rat |
| Antigen | A1CF antibody was raised using the N terminal of A1CF corresponding to a region with amino acids MESNHKSGDGLSGTQKEAALRALVQRTGYSLVQENGQRKYGGPPPGWDAA |
| Purity/Format | Affinity purified |
| Blocking Peptide | A1CF Blocking Peptide |
| Description | Rabbit polyclonal A1CF antibody raised against the N terminal of A1CF |
| Gene | A1CF |
| Supplier Page | Shop |