VDR antibody

Name VDR antibody
Supplier Fitzgerald
Catalog 70R-1930
Prices $345.00
Sizes 50 µg
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human, Mouse, Rat
Antigen VDR antibody was raised using the N terminal of VDR corresponding to a region with amino acids ILKRKEEEALKDSLRPKLSEEQQRIIAILLDAHHKTYDPTYSDFCQFRPP
Purity/Format Affinity purified
Blocking Peptide VDR Blocking Peptide
Description Rabbit polyclonal VDR antibody raised against the N terminal of VDR
Gene VDR
Supplier Page Shop

Product images

This product has images. Please go to Supplier's page for details.